KEGG   Geobacter sp. M21: GM21_2219Help
Entry
GM21_2219         CDS       T00933                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gem  Geobacter sp. M21
Pathway
gem00010  Glycolysis / Gluconeogenesis
gem00052  Galactose metabolism
gem00500  Starch and sucrose metabolism
gem00520  Amino sugar and nucleotide sugar metabolism
gem00521  Streptomycin biosynthesis
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01120  Microbial metabolism in diverse environments
gem01130  Biosynthesis of antibiotics
gem01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_2219
   00052 Galactose metabolism
    GM21_2219
   00500 Starch and sucrose metabolism
    GM21_2219
   00520 Amino sugar and nucleotide sugar metabolism
    GM21_2219
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GM21_2219
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GM21_2219
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GM21_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACT18269
JGI: GM21_2219
UniProt: C6DYI5
Position
complement(2589106..2590089)
Genome map
AA seq 327 aa AA seqDB search
MVILAGDVGGTSTRLAYFEYAATGLVVLAEGRYQSQEHSSLSDIVRRFAAQYRFDADRAC
FGIAGPVIDGRVRTPNLPWNIDGSELAAALGLDQVRLINDLEANTYGIAELKAQDLLTLN
PGAADPTGTIAVVSAGTGLGESLAYWDGSAHRPLPSEAGHADFAARNDLEADLLLYLQGK
HGRVSYERVLSGPGLLDIYRFLRDRHYFQEDEAIIAAMNAGDAPAVITRAAMAGTCPMCS
KALDIFITVYGAEAGNAALRFLATGGVYLGGGIAPKILDKLRGASFIVAFTAKGRLSSLV
QTIPVHVILNERTALLGAGRAASISSS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcatacttgctggagacgtcggcgggacctcgacccggctagcctacttcgagtac
gctgcaaccgggctcgtggtgctggccgagggacgctaccaaagccaggaacacagcagt
ctctccgacatcgtgcgccgctttgccgcccaataccgcttcgacgccgacagggcctgc
ttcggcatagccggaccggtcatcgacgggcgggtacggaccccgaacctcccctggaac
atcgacggcagcgaacttgccgcagccttaggtctagaccaggtgcgcctgatcaacgat
ctcgaggccaacacctacggcatcgcggaactgaaggcgcaggacctgctgacgctcaac
ccgggagcggcggaccccacaggcaccatagccgtggtttccgccggcaccgggcttggg
gaatcgcttgcctactgggacggctccgcccacagaccgcttcccagcgaggcggggcat
gccgacttcgcggcgcgaaacgatctcgaggccgatcttttgctctacctccaggggaag
catggccgggtcagttacgagcgcgtcctgtcgggaccggggctcctcgatatctaccgg
tttctcagggacaggcattacttccaggaggatgaagcgatcattgccgccatgaacgcg
ggagacgcccccgcggtcatcacccgcgccgcaatggccggaacttgcccgatgtgcagc
aaggctctcgatatcttcatcactgtgtacggtgccgaagccgggaatgcagctctcagg
tttctcgccacaggcggagtctatctcggcgggggaatcgcgcccaagatcctggacaag
ctgcgcggggcttccttcatcgtagccttcacggcaaaggggcgtctcagctctttggtg
caaacaattccggtgcacgtcatattaaatgagagaaccgcactgctaggtgcgggtagg
gctgcttcaatctcatccagttga

DBGET integrated database retrieval system