KEGG   Geobacter sp. M21: GM21_2219Help
Entry
GM21_2219         CDS       T00933                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gem  Geobacter sp. M21
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM21_2219
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_2219
   00052 Galactose metabolism
    GM21_2219
   00500 Starch and sucrose metabolism
    GM21_2219
   00520 Amino sugar and nucleotide sugar metabolism
    GM21_2219
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GM21_2219
   00524 Butirosin and neomycin biosynthesis
    GM21_2219
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GM21_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2589106..2590089)
Genome map
AA seq 327 aa AA seqDB search
MVILAGDVGGTSTRLAYFEYAATGLVVLAEGRYQSQEHSSLSDIVRRFAAQYRFDADRAC
FGIAGPVIDGRVRTPNLPWNIDGSELAAALGLDQVRLINDLEANTYGIAELKAQDLLTLN
PGAADPTGTIAVVSAGTGLGESLAYWDGSAHRPLPSEAGHADFAARNDLEADLLLYLQGK
HGRVSYERVLSGPGLLDIYRFLRDRHYFQEDEAIIAAMNAGDAPAVITRAAMAGTCPMCS
KALDIFITVYGAEAGNAALRFLATGGVYLGGGIAPKILDKLRGASFIVAFTAKGRLSSLV
QTIPVHVILNERTALLGAGRAASISSS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcatacttgctggagacgtcggcgggacctcgacccggctagcctacttcgagtac
gctgcaaccgggctcgtggtgctggccgagggacgctaccaaagccaggaacacagcagt
ctctccgacatcgtgcgccgctttgccgcccaataccgcttcgacgccgacagggcctgc
ttcggcatagccggaccggtcatcgacgggcgggtacggaccccgaacctcccctggaac
atcgacggcagcgaacttgccgcagccttaggtctagaccaggtgcgcctgatcaacgat
ctcgaggccaacacctacggcatcgcggaactgaaggcgcaggacctgctgacgctcaac
ccgggagcggcggaccccacaggcaccatagccgtggtttccgccggcaccgggcttggg
gaatcgcttgcctactgggacggctccgcccacagaccgcttcccagcgaggcggggcat
gccgacttcgcggcgcgaaacgatctcgaggccgatcttttgctctacctccaggggaag
catggccgggtcagttacgagcgcgtcctgtcgggaccggggctcctcgatatctaccgg
tttctcagggacaggcattacttccaggaggatgaagcgatcattgccgccatgaacgcg
ggagacgcccccgcggtcatcacccgcgccgcaatggccggaacttgcccgatgtgcagc
aaggctctcgatatcttcatcactgtgtacggtgccgaagccgggaatgcagctctcagg
tttctcgccacaggcggagtctatctcggcgggggaatcgcgcccaagatcctggacaag
ctgcgcggggcttccttcatcgtagccttcacggcaaaggggcgtctcagctctttggtg
caaacaattccggtgcacgtcatattaaatgagagaaccgcactgctaggtgcgggtagg
gctgcttcaatctcatccagttga

DBGET integrated database retrieval system