KEGG   Geobacter sp. M21: GM21_2324Help
Entry
GM21_2324         CDS       T00933                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gem  Geobacter sp. M21
Pathway
gem00220  Arginine biosynthesis
gem00330  Arginine and proline metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01130  Biosynthesis of antibiotics
gem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GM21_2324
   00330 Arginine and proline metabolism
    GM21_2324
Enzymes [BR:gem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GM21_2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACT18372
JGI: GM21_2324
UniProt: C6DZ64
Position
complement(2702760..2703650)
Genome map
AA seq 296 aa AA seqDB search
MESRVRMIGVPLDLGQEQRGVDLGPGALRYAGLSARLAGLGYQVEDIGNLEVPVRDVVTA
ERERHYLPSIGKVCETVYQAGRAAVAQGCIPVFMGGDHSLALGSIGGVTHEEPTAVIWVD
AHGDFNTPETSPSGNIHGMVLAALLGEGYPELVHLGRPGAKLTGNDVVLIGLRELDPGEK
ARLRDSSLTVYTMRDIDERGIGAIAREALGKLAHRTRLHLSLDLDGLDPLEVPGVGTTSP
GGITYREAQLLMEIVADTKLLRSMDIVEINPILDHSNRTAKIAVELAASAFGEAIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagagccgtgtcaggatgataggcgtgccgctggacctggggcaggagcagcgcggc
gtcgacttgggcccgggggctctgcgctatgcggggctgtcggcgcgtctcgccggtctg
gggtaccaggtggaggatatagggaacctggaggtgccggtacgggacgtggtgaccgcc
gagcgggagcggcattacctcccctcgatagggaaggtctgcgagacggtttatcaggca
gggcgcgcggcggtggcgcaaggctgcatccccgtcttcatggggggggaccattcgctg
gcgcttggctccataggcggggtgacccacgaagagccgacggcggtgatctgggtcgac
gcccacggcgacttcaacacgcctgagacctcccccagcggaaacattcacgggatggtg
ttggcggcgcttttgggcgaagggtatccggaactggtgcacctggggaggccgggggcg
aagcttaccggcaacgacgtggtcctgatcgggctgcgggaactggatcccggggaaaag
gcgaggctgcgcgacagctccctcaccgtctacaccatgcgggacatagacgagcggggt
atcggcgccatcgcccgggaggcgctgggaaaactcgcccacaggacgcgcctgcacctg
agcctcgatctcgacggcctggacccgctggaggttcccggcgtcggcaccacctctccg
ggaggaatcacctatcgcgaggcgcagctcttgatggagatcgtcgccgacacgaagctc
cttcgttccatggacatcgtggagataaatccgatcctggaccatagcaaccgcacggcc
aagatcgccgtggaactggccgcctccgctttcggggaggcgatcctgtaa

DBGET integrated database retrieval system