KEGG   Geobacter sp. M21: GM21_2718Help
Entry
GM21_2718         CDS       T00933                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gem  Geobacter sp. M21
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GM21_2718
   00052 Galactose metabolism
    GM21_2718
   00500 Starch and sucrose metabolism
    GM21_2718
   00520 Amino sugar and nucleotide sugar metabolism
    GM21_2718
Enzymes [BR:gem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GM21_2718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3166566..3167432)
Genome map
AA seq 288 aa AA seqDB search
MRVKKAVFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRGK
RAIEDHFDISFELESLLYEKGKDQELHQVRQIAEMANIFFVRQKEALGLGHAILCAKEFI
GDEPFAVLLGDDIIDAEKPCLSQLLETYESYRSPVLALEQVPIENISSYGCVRANHLANR
AYEVLDLVEKPPVAEAPSDLAIIGRYILTPGIFPILENQEPGKGGEIQLTDAIKTLSREE
PIYGCRFDGIRHDCGDKLGFLKATVDMALKRDEFNGEFLTFLRRRLGC
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaagaaggctgttttccccgtcgccggtctcggcaccaggtttttgcccgcg
accaaatcgactcccaaggagatgctgccgctcatagacaagcctctggtccagtacgtg
gtggaggaggcggtcgcgtccggcatcgagcagatcctcttcgtcaccgggcgcggcaag
agggcgatcgaggaccacttcgacatctccttcgagctggaatcgcttctctacgagaag
gggaaggaccaggaactgcaccaggtgcgccagatcgcggagatggccaacatcttcttc
gtgcgccagaaggaggcactgggacttggccacgccatcctctgcgccaaggagttcatc
ggcgacgagcctttcgccgtccttttgggcgacgacatcatcgacgccgagaagccttgc
ctgtcccagctcctggagacctacgagagctaccgctcccccgtactcgccctggagcag
gttcccatcgagaacatctcctcctacggctgcgtacgcgcgaaccacctggccaaccgc
gcctacgaggtgctcgacctggtggagaagccgccggtcgccgaggccccgtcggattta
gccatcatcggccgctacatactcactccggggatcttcccgatcctggagaaccaggag
ccggggaaggggggggagatccagttgaccgacgccatcaagacgctctcgcgcgaggag
ccgatctatggctgccgtttcgacggcatacgccacgactgcggcgacaagctgggcttt
ttgaaggcgacggtggatatggcactgaaaagggacgagttcaacggggagtttctgacg
tttttaaggaggaggcttggctgctaa

DBGET integrated database retrieval system