KEGG   Geobacter sp. M21: GM21_2985Help
Entry
GM21_2985         CDS       T00933                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gem  Geobacter sp. M21
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GM21_2985
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM21_2985
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GM21_2985
Enzymes [BR:gem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GM21_2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3467946..3469322
Genome map
AA seq 458 aa AA seqDB search
MKYISTRGKIAPVGFKDAVMMGLATDGGLILPESIPQIDRGTLAAWSKLPYRELAFNVIS
LFATDIPAADLKELIDRSYGSFEHQETTPLVKKDGVYILELFHGPTLAFKDVALQLLGNL
FEYLLKERGEKMNILGATSGDTGSAAIAGVRGKENINIFILHPHLKTSPIQALQMTSVLD
ENVHNVAVEGTFDDCQNIVKSLFNDLQFKKEYALGAVNSINWARVLAQVVYYFYAWGRLP
EQKEVIFSVPTGNFGDIFAGYLAKRMGLPVEKLLLATNENNILSRFVQTGDYSLGKVVQT
VSPSMDIQLASNLERYLYYLWDENPEKVQSAFAELQSTGRIAFTNEQVLRVQAEFMSCTV
DEQKTLDTIASFNRETGYLLDPHTAVGVRGALVCAPGHPRVVCLATAHPAKFGDAVERAV
GSPPPLPPALAALVGKETRCELMAPDQEKIKAFVKAKA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacataagcaccaggggaaagatagcgccggtcggtttcaaggacgcggtcatg
atgggacttgccaccgacggcgggctgattcttccggaatcgatcccgcagatcgaccgc
ggcaccctggccgcctggtccaagctcccctaccgcgagctcgccttcaacgtcatctcc
cttttcgccacggacatcccggctgcggacctgaaggagctcatcgaccgctcctacgga
agcttcgagcaccaggagaccaccccgctggtgaaaaaggacggcgtctatatcctggag
ctcttccacggccccaccctcgccttcaaggacgtggcgctgcagcttctgggcaatctc
ttcgagtaccttttgaaggagcgcggggagaagatgaacatcctcggcgccacatcgggc
gacaccgggagcgcggccatcgccggggtgcgcggcaaggagaacatcaacatcttcatc
ctgcatccgcacctgaagacctcgccgatccaggcgctgcagatgaccagcgtgctcgac
gagaacgtgcacaacgtcgcggtggaggggaccttcgacgactgccagaacatcgtgaag
agcctcttcaacgaccttcagttcaagaaggagtacgcgctcggcgcggtgaactcgatc
aactgggcgcgggtcttggcccaggtcgtctactacttctacgcctgggggaggctcccg
gagcaaaaagaggtgatcttctccgtccccaccggcaacttcggcgacatcttcgccggc
tacctcgccaagcggatggggctccccgtggagaagctgcttcttgccaccaacgagaac
aacatcctctcccgcttcgtgcaaaccggcgactattcgctcgggaaggtggtgcagacc
gtctccccctccatggacatccagctcgcctccaaccttgagcgctacctctactacctc
tgggacgagaacccggaaaaggtgcaaagcgccttcgccgaactgcagtcgaccggcagg
atcgcgttcacgaacgagcaggtgctaagggtgcaggcggagttcatgagctgcacggtg
gacgagcagaagaccctggacaccatcgcctccttcaaccgcgaaaccggctacctcctc
gacccccacaccgcggtcggcgtgcgcggcgccctggtatgcgcgccgggccacccgagg
gtggtctgcctcgccaccgcccacccggcgaaattcggggatgccgtcgagcgcgccgta
ggctccccccccccgcttcccccggcactcgcggccctggtggggaaagagacccgctgc
gagctgatggcgcccgaccaggagaagatcaaggcgttcgtcaaggccaaggcttaa

DBGET integrated database retrieval system