KEGG   Geobacter sp. M21: GM21_3246Help
Entry
GM21_3246         CDS       T00933                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gem  Geobacter sp. M21
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GM21_3246
Enzymes [BR:gem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GM21_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3776072..3777559)
Genome map
AA seq 495 aa AA seqDB search
MVRQRKSGVLLHPSSLPGAGGIGSFGEEARRFVDFLHKSGQSLWQILPLGPTAYGNSPYS
CYSAFAGNPLLVNLEAVQDDGDLLPLETRPDLSTGRIDFPSVEEYKLGRLRDAAARFFAE
APQKRKEEFWQFCDGTFWLHDFALFMALKEEFKGVSWKDWPDTLANREPAALSFWSEKLG
TAIGEQKYQQWQFARQWKKLKSYANVLGISVVGDLPIFVAYDSADVWANPHLFHLDEKGV
PIVVAGVPPDYFSKTGQLWGNPLYNWEQMAKEGYGWWIARLRNDLCLYDMVRIDHFRGFE
AFWEVPMWEKTAINGRWVKGPGEALFHALRNALGNLPIIAEDLGIITPEVESLREQFGFP
GMKILQFAFGSGPENPYLPHNHVRSCVVYTGTHDNDTTVGWFDTLKTKEQKNVLAYFDRD
GGDIVWQMVKCALASVADYAIIPMQDLLELPSSGRMNVPGVAGGNWSWRCPGDAFSGRLA
AKLARATELYGRLPD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtgagacagagaaagagtggggtactgttgcaccccagctcgttgccaggagccgga
ggcataggttcatttggcgaagaggcgcggcgcttcgttgactttctgcacaagtcaggt
cagtcactctggcagatccttccccttggccctacggcctacggaaactccccatattcc
tgttactcggcctttgccggcaacccccttctggtcaacctagaagcagtccaggacgat
ggggatctattgcccctggaaacgaggcccgatctttccaccggccggatagatttcccg
tcggtcgaagaatacaagctggggcgtctgagggatgcggccgcgcggttttttgccgag
gcgccgcaaaagcgcaaagaggaattttggcaattctgcgatggcaccttttggctgcac
gatttcgcgctcttcatggcgctgaaggaggaattcaagggtgttagctggaaggattgg
ccggatacgctggccaaccgggagccggctgcgctttccttctggagcgagaaattaggt
accgccatcggcgagcagaagtaccagcagtggcagttcgctcggcaatggaagaagttg
aaaagctatgcgaacgttctcggcatctcggtggtcggcgacctcccgatcttcgtcgcc
tacgattcggcagatgtctgggccaatccgcaccttttccacctggatgagaagggggtt
cctattgttgtggcgggggtgccaccggattacttcagtaagaccgggcagctctggggg
aatccgctttataactgggaacagatggccaaagaggggtacggctggtggatcgcgagg
ctgcgtaacgacctttgcctctacgacatggtgcgcattgatcacttccgcggcttcgag
gctttctgggaagtaccgatgtgggagaagaccgcgatcaacggccgctgggtgaaaggc
ccgggtgaggcgttgttccatgccttgcgcaacgcgctggggaacctccccatcatcgcg
gaggacctcggcattatcacgcctgaggtggaatctctccgggaacaattcggtttcccc
ggcatgaaaattctgcagttcgccttcggatccgggcccgaaaatccgtatctgcctcac
aaccatgtccgctcctgcgtggtctacaccgggacccacgacaacgacaccacggtaggg
tggttcgacaccctgaagacgaaggagcaaaagaacgtgctggcctatttcgaccgggac
ggaggcgacatcgtctggcagatggtgaaatgcgccctcgcctcggttgccgactacgcc
atcatccccatgcaggatctgctggaactgcccagcagtggccgaatgaacgttcctggc
gtcgccggaggcaactggagctggagatgccccggcgacgccttctccggcaggctcgcc
gccaaactcgcacgggctaccgaactttacgggagattgccagactga

DBGET integrated database retrieval system