KEGG   Geobacter sp. M21: GM21_3570Help
Entry
GM21_3570         CDS       T00933                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gem  Geobacter sp. M21
Pathway
gem00010  Glycolysis / Gluconeogenesis
gem00260  Glycine, serine and threonine metabolism
gem00680  Methane metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01120  Microbial metabolism in diverse environments
gem01130  Biosynthesis of antibiotics
gem01200  Carbon metabolism
gem01230  Biosynthesis of amino acids
Module
gem_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_3570
  Energy metabolism
   00680 Methane metabolism
    GM21_3570
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM21_3570
Enzymes [BR:gem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GM21_3570
Membrane trafficking [BR:gem04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GM21_3570
Exosome [BR:gem04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GM21_3570
  Exosomal proteins of melanoma cells
   GM21_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACT19591
JGI: GM21_3570
UniProt: C6E639
Position
4150224..4150928
Genome map
AA seq 234 aa AA seqDB search
MHQLVLLRHGESVWNKENLFTGWTDVELSPSGEEESRKAGLLLKEHGFVFDMAFTSLLKR
AIKTLWIVLEQMDLMWIPERKEWRLNERHYGALQGLNKAQTAEQYGDEQVKLWRRSYKVR
PPALAEGDRRHPSFDPRYHSLQGELLPSTECLQDTVERVLPFWRQQAVPALRQGKRILIA
AHGNSLRGLIKYLDQVSDEDIVGLEIPTGSPLVYELDSDLKPMRHYYLETGKTG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaactggtgctgctaaggcatggcgagagcgtctggaacaaggagaacctcttc
accgggtggaccgacgtggagctctcccccagtggggaggaggagagccgcaaggcgggg
ctgctcctgaaggagcacggtttcgtcttcgacatggccttcacttcgctcttgaagcgg
gcgataaagacgctttggatcgtgctggagcagatggacctgatgtggattccggagcgc
aaggaatggcgcctgaacgagaggcattacggcgcgctgcaggggttgaacaaggcccag
accgcggagcagtacggggacgagcaggtgaaactctggaggcgcagctataaggtgcgg
ccgccggcgctcgcggagggagaccggcggcacccgtcgttcgacccgcgttaccactcc
ctgcagggagagctgctcccaagcaccgaatgcctgcaggacacggtcgagcgcgtgctt
cccttctggcggcagcaggcggtccccgccctccggcaaggaaagcggatattgatcgcg
gcgcacggcaacagcctgcgggggctgatcaagtacctggaccaggtatccgacgaagac
atcgtgggtttggagatcccgaccgggagtccgctggtgtacgaactggacagcgacctg
aaacccatgcgccactactatctggagacggggaaaaccggatga

DBGET integrated database retrieval system