KEGG   Geobacter sp. M21: GM21_3570Help
Entry
GM21_3570         CDS       T00933                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gem  Geobacter sp. M21
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GM21_3570
   01230 Biosynthesis of amino acids
    GM21_3570
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GM21_3570
  Energy metabolism
   00680 Methane metabolism
    GM21_3570
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GM21_3570
Enzymes [BR:gem01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GM21_3570
Exosome [BR:gem04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GM21_3570
  Exosomal proteins of melanoma cells
   GM21_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4150224..4150928
Genome map
AA seq 234 aa AA seqDB search
MHQLVLLRHGESVWNKENLFTGWTDVELSPSGEEESRKAGLLLKEHGFVFDMAFTSLLKR
AIKTLWIVLEQMDLMWIPERKEWRLNERHYGALQGLNKAQTAEQYGDEQVKLWRRSYKVR
PPALAEGDRRHPSFDPRYHSLQGELLPSTECLQDTVERVLPFWRQQAVPALRQGKRILIA
AHGNSLRGLIKYLDQVSDEDIVGLEIPTGSPLVYELDSDLKPMRHYYLETGKTG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaactggtgctgctaaggcatggcgagagcgtctggaacaaggagaacctcttc
accgggtggaccgacgtggagctctcccccagtggggaggaggagagccgcaaggcgggg
ctgctcctgaaggagcacggtttcgtcttcgacatggccttcacttcgctcttgaagcgg
gcgataaagacgctttggatcgtgctggagcagatggacctgatgtggattccggagcgc
aaggaatggcgcctgaacgagaggcattacggcgcgctgcaggggttgaacaaggcccag
accgcggagcagtacggggacgagcaggtgaaactctggaggcgcagctataaggtgcgg
ccgccggcgctcgcggagggagaccggcggcacccgtcgttcgacccgcgttaccactcc
ctgcagggagagctgctcccaagcaccgaatgcctgcaggacacggtcgagcgcgtgctt
cccttctggcggcagcaggcggtccccgccctccggcaaggaaagcggatattgatcgcg
gcgcacggcaacagcctgcgggggctgatcaagtacctggaccaggtatccgacgaagac
atcgtgggtttggagatcccgaccgggagtccgctggtgtacgaactggacagcgacctg
aaacccatgcgccactactatctggagacggggaaaaccggatga

DBGET integrated database retrieval system