KEGG   Geobacter sp. M21: GM21_3603Help
Entry
GM21_3603         CDS       T00933                                 

Definition
(GenBank) L-threonine-O-3-phosphate decarboxylase
  KO
K04720  threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
gem  Geobacter sp. M21
Pathway
gem00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GM21_3603
Enzymes [BR:gem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.81  threonine-phosphate decarboxylase
     GM21_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DPRP
Motif
Other DBs
NCBI-ProteinID: ACT19624
JGI: GM21_3603
UniProt: C6E672
Position
complement(4181570..4182682)
Genome map
AA seq 370 aa AA seqDB search
MPLVKTHDPSIPGMDRKKHEHGGNVFAVARMLGVAPEQILDFSASINPLGMAPGVRDALA
GCLDRLVHYPDKGAAELRERIAQYHGVSTAEIAVASGSTELIHLLPRVVGGKKGLIVAPA
FAEYAEALNRSGWEIDYLTLSSADNFALPLPLLWEKLGEGVDMVFICNPGNPTGALMPRR
EIEAVVELCREHGTFLVLDEAFMDFCEEESAKFLVRQSPRAVLLRSMTKFFAIPGLRLGY
AIAAPQTVEAIAALQDPWSVNTAAQVAGVASLGDADYCLRTREYVDAEREHLAKGLAAIP
GLRVFSSRANYLLVEIRDGRSASEIRERLMPEGVLVRDCGNFEGLDGRFFRVAVRLREEN
ERLLELLRKA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttggttaaaacacacgacccttcaatacccggcatggaccggaaaaaacacgaa
catggcggcaacgtcttcgcggtggccaggatgctgggcgttgcgccggagcagatcctc
gacttctcggcgagcatcaatccgctggggatggcgccgggggtgcgcgacgcacttgcc
ggctgcctggaccgcctggtccattacccggacaagggtgccgccgagttgagggaacgg
atcgcgcagtaccacggggtgagcacggctgagatcgccgtggccagcggttcgacggag
ctgatacatctcctcccccgggtggtgggcgggaaaaagggactcatcgtggcgccggcc
ttcgcggagtacgccgaggcgcttaaccgctccggttgggaaatcgactacctcaccctg
tccagcgccgacaacttcgcgctgccgctccccctgctttgggaaaagctcggggaaggg
gtcgacatggtattcatctgcaaccccggcaacccgacgggggcgctgatgccgcgacgc
gagatagaggcggtggtggaactctgccgcgagcacgggacattcctggtgctggacgag
gcgttcatggatttctgcgaggaggagtcggcgaagttcctggtgcgccaatccccgcgg
gcggtcctgctgcggtccatgacaaagttcttcgccatccccgggttgcggctggggtac
gccatcgccgcgccgcagacggtcgaggccatcgccgccctgcaggacccctggagcgtg
aacaccgccgcccaggtcgcaggcgtggcgtctttgggcgatgcggattattgcctgcgc
accagggaatacgtggacgccgaacgcgagcacctggcaaagggacttgccgccatcccc
ggcctgagggttttctcctcgcgcgccaactatttgctggtcgagatccgcgacggacgg
agtgcgagcgagatccgcgaaaggctgatgccggaaggtgtgctggtgagggactgcggg
aacttcgagggtttggacggacggttcttcagggtggcggtgcggcttagggaggaaaac
gagcgcctgctggaactgcttcggaaggcgtga

DBGET integrated database retrieval system