KEGG   Geobacter sp. M21: GM21_3603Help
Entry
GM21_3603         CDS       T00933                                 

Definition
L-threonine-O-3-phosphate decarboxylase
Orthology
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
gem  Geobacter sp. M21
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gem00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4181570..4182682)
Genome map
AA seq 370 aa AA seqDB search
MPLVKTHDPSIPGMDRKKHEHGGNVFAVARMLGVAPEQILDFSASINPLGMAPGVRDALA
GCLDRLVHYPDKGAAELRERIAQYHGVSTAEIAVASGSTELIHLLPRVVGGKKGLIVAPA
FAEYAEALNRSGWEIDYLTLSSADNFALPLPLLWEKLGEGVDMVFICNPGNPTGALMPRR
EIEAVVELCREHGTFLVLDEAFMDFCEEESAKFLVRQSPRAVLLRSMTKFFAIPGLRLGY
AIAAPQTVEAIAALQDPWSVNTAAQVAGVASLGDADYCLRTREYVDAEREHLAKGLAAIP
GLRVFSSRANYLLVEIRDGRSASEIRERLMPEGVLVRDCGNFEGLDGRFFRVAVRLREEN
ERLLELLRKA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttggttaaaacacacgacccttcaatacccggcatggaccggaaaaaacacgaa
catggcggcaacgtcttcgcggtggccaggatgctgggcgttgcgccggagcagatcctc
gacttctcggcgagcatcaatccgctggggatggcgccgggggtgcgcgacgcacttgcc
ggctgcctggaccgcctggtccattacccggacaagggtgccgccgagttgagggaacgg
atcgcgcagtaccacggggtgagcacggctgagatcgccgtggccagcggttcgacggag
ctgatacatctcctcccccgggtggtgggcgggaaaaagggactcatcgtggcgccggcc
ttcgcggagtacgccgaggcgcttaaccgctccggttgggaaatcgactacctcaccctg
tccagcgccgacaacttcgcgctgccgctccccctgctttgggaaaagctcggggaaggg
gtcgacatggtattcatctgcaaccccggcaacccgacgggggcgctgatgccgcgacgc
gagatagaggcggtggtggaactctgccgcgagcacgggacattcctggtgctggacgag
gcgttcatggatttctgcgaggaggagtcggcgaagttcctggtgcgccaatccccgcgg
gcggtcctgctgcggtccatgacaaagttcttcgccatccccgggttgcggctggggtac
gccatcgccgcgccgcagacggtcgaggccatcgccgccctgcaggacccctggagcgtg
aacaccgccgcccaggtcgcaggcgtggcgtctttgggcgatgcggattattgcctgcgc
accagggaatacgtggacgccgaacgcgagcacctggcaaagggacttgccgccatcccc
ggcctgagggttttctcctcgcgcgccaactatttgctggtcgagatccgcgacggacgg
agtgcgagcgagatccgcgaaaggctgatgccggaaggtgtgctggtgagggactgcggg
aacttcgagggtttggacggacggttcttcagggtggcggtgcggcttagggaggaaaac
gagcgcctgctggaactgcttcggaaggcgtga

DBGET integrated database retrieval system