KEGG   Geobacter sp. M21: GM21_3799Help
Entry
GM21_3799         CDS       T00933                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
gem  Geobacter sp. M21
Pathway
gem00340  Histidine metabolism
gem01100  Metabolic pathways
gem01110  Biosynthesis of secondary metabolites
gem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GM21_3799
Enzymes [BR:gem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GM21_3799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACT19818
JGI: GM21_3799
UniProt: C6E7F8
Position
complement(4371058..4372347)
Genome map
AA seq 429 aa AA seqDB search
MQFLDIREADFQAKFDAIVERGEESGREVEEVVLGIIADVRSRGDEALLEYTRRFDRLEC
DAAGLEVTPEEFEKALAKVDQKDLAALKLAVERVARFHEKQKQQSWISTEESDIMVGQKV
TPLAKVGIYVPGGKACYPSSVVMNAVPAKVAGVGEIVMVVPAPGGEMNPHVLTAAKLSGV
DRVFRIGGAQAVAALAYGTATVPKVDKITGPGNIYVATAKKLVFGQVGIDMIAGPSEILV
INDGSGNPVHVAADLLSQAEHDELASSVLITTDRSFGEQVAAEVERQLKELSREVIARKS
WESFGVIIVAGNLEEAIAFSNRIAPEHLELAVENPFEILPLITNAGAIFMGHYTPEAAGD
YLAGPNHTLPTGGTARFFSPLSVDDFVKKSSIIHFTRGGLERVGEDIVRISRLEGLDAHG
RSVSLRLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcagttccttgacattagggaagcagattttcaggcgaaattcgacgccatagtggag
cgcggcgaggagtccgggcgcgaggtcgaggaggttgtcctcggcatcatcgccgacgtc
aggagccgcggcgacgaggcgcttctggaatacaccaggcgctttgaccggctggagtgc
gacgccgccgggctggaggtgacgcctgaggaattcgagaaggcgttggccaaggtggac
cagaaggacctggcggcgctgaaactcgcggtggagagggtggcccgctttcacgagaaa
cagaagcagcagagctggatctccaccgaggagagcgacatcatggtggggcagaaggtg
actccgctcgccaaggtcggcatctacgtacccggcggcaaggcctgctacccttccagc
gtcgtcatgaacgccgtccccgccaaggtcgccggcgtgggcgagatcgtcatggtagtg
ccggcccccggcggcgagatgaacccgcacgtgctgaccgcggcgaaactctccggcgtg
gaccgcgtctttcgcatcggcggcgctcaggcggtagcggcgctagcctacggcacggcc
accgtccccaaggtcgacaagatcaccggccccggcaacatctacgtggccacggccaag
aagctcgtcttcggccaggtcggcatcgacatgatcgcggggccgagcgagatcctggtc
atcaacgacggcagcggcaacccggtccacgtggcggcggatctcctctcccaggcggag
cacgacgagcttgcctcctccgtgctgatcaccaccgaccgcagcttcggcgagcaggtg
gcggccgaggtggagcgccagttgaaagagctctcccgtgaggtgatcgcgcgcaagtcc
tgggaatccttcggcgtcatcatcgtggccgggaacctggaggaggccatcgcgttttcc
aaccggatcgctcccgagcacctggagcttgccgtcgagaaccccttcgagatcctgccg
ctcatcaccaacgccggcgccatcttcatggggcactacacccccgaagcggccggcgac
tacctggccggacccaaccataccctccccaccggcgggacggcgcgctttttctcgccg
ctctccgtggacgatttcgtcaagaaaagctccatcatccacttcacccgcggcggcctt
gagcgcgtcggcgaggacatcgtcaggatctcccgcctggaagggctcgacgcccacggc
aggtcggtgagcctcaggttggagaagtag

DBGET integrated database retrieval system