KEGG   Geobacter sp. M21: GM21_3802Help
Entry
GM21_3802         CDS       T00933                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gem  Geobacter sp. M21
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gem00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GM21_3802
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GM21_3802
Enzymes [BR:gem01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     GM21_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4373383..4374648)
Genome map
AA seq 421 aa AA seqDB search
MEKLVIKGGNKLSGEVTVSGSKNAALPIFISTILAPGCHTISNVPFLRDINTTIKVLEKL
GATVDGRGNVVKIDTTNLNSFEATYDLVRTMRASVLVLGPLLARFGQARVSLPGGCAIGA
RPINLHLKGLAALGAEITLEHGYVEAKAKKLKGARINFDISTVGGTEQLLMAAATAQGET
VLENAAREPEIVDLAEILIKMGADIEGAGTDTIRIKGVEALTAAEHAVMPDRIEAGTFMI
ASAITGGDIKIKNMRLDHLDALSFKLQDAGVEITNKDNMVRVKGPKKIRNVNIKTRPYPG
FPTDMQAQFMALMCIAEGASVISENIFENRFMHVSELLRFGADIICEGNSATVKGVKKLS
GAPVMATDLRASASLILAALAADNTSEISRIYHLDRGYESIEKKLAGLGADIARVPDEEG
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaactggtaattaaaggtggcaacaagctctccggagaagtgaccgttagcgga
tccaagaacgctgccctccccatattcatctccaccatcctggctccgggatgccacacc
atcagcaacgttcccttccttagggacatcaacaccaccatcaaggtgctggagaagctg
ggggcgacggtcgacggcagggggaacgtggtcaagatcgacaccaccaacctgaacagc
ttcgaggcgacctacgacctggtgcgcaccatgcgcgcctcggtcctcgtgctcggcccg
ctcctggcgcgcttcggccaggcccgcgtctcgcttccggggggatgcgccataggcgcc
cgcccgatcaacctgcacctcaaagggctagcggcgctgggcgccgagatcaccctggag
cacggctacgtcgaggcgaaggcgaaaaagctcaagggggcgcgcatcaacttcgacatc
tccaccgtcggcggcaccgagcagctcctgatggcggcggccacggcgcagggggagacc
gttctggagaacgcggcgcgtgagccggagatcgtcgatctcgccgagatcctgatcaag
atgggggcagacatcgagggggccggcaccgacaccatccgcatcaagggggtcgaggcg
ctcaccgccgccgagcacgccgtgatgccggaccgcatcgaggccgggaccttcatgatc
gcatccgccatcaccggcggcgatatcaagatcaagaacatgcgtctggaccacctggac
gcactctccttcaaactgcaggacgccggcgtcgagatcaccaacaaggacaacatggtc
cgcgtcaaaggccccaagaagatccggaacgtgaacatcaagacgagaccgtaccccggt
tttccgactgacatgcaggcccagttcatggcgctcatgtgcatcgccgagggggccagc
gtcatctcggagaacatcttcgagaaccgcttcatgcacgtctccgagctgcttcgcttc
ggcgccgacatcatctgcgaggggaacagcgccacggtgaagggggtcaagaagctctcc
ggggctccggtcatggccaccgacctgcgcgcctccgcgtcgctgattctggcagccctc
gccgccgacaacaccagcgagatctccaggatctaccacctggaccgcggctacgaaagc
atcgagaagaagctcgccggtctcggcgccgacatagcccgcgtcccggacgaagaaggc
ccctag

DBGET integrated database retrieval system