KEGG   Geobacter daltonii FRC-32: Geob_0212Help
Entry
Geob_0212         CDS       T00846                                 

Definition
(RefSeq) Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
  KO
K19515  
benzoyl-CoA reductase subunit BamB [EC:1.3.-.-]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Module
Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geob_0212
Enzymes [BR:geo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.-  Acting on the CH-CH group of donors
    1.3.-.-  
     Geob_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
254505..256463
Genome map
AA seq 652 aa AA seqDB search
MRYAETGYVLEVDLTKGSIERVATDPKDTELYLGGLGTNAKLLWDRVPPEVDPFSPDNLL
IFAAGLLCGTPATGCNRTIVSTISPQTRLMAFSMMGGFWAPELKYAGYDKVILRGKSPDL
VYLYINNDKVEIRDASHLKGKGAIETAEIIKKELDEPRAQVAAIGLAGENRVYYASIEQG
RSSASRGGIGAVMGDKGVKAVVVRGTKDLCVAKPQEYMDLCNEVLDYIKHREENPIPDVM
PILAGLGSPQEMKVHDEKWHTENFNWGNARTRRKDFWTEEVDHAWAETMEKARTRLISCY
NCPMKCGATISMEGLPTYMMKCFTKLTYTMAAYSDLDFGLRIAQKATEYGLDGFSAPQVM
AFAFELLEKGILTEKDFPGLPEDNEEKFFYLLDKIVRRDGIGDVLANGTYWAAQEIGKGA
EEYAHNNIKKHEQLPLKLSMLNPIYYLMYCTGEKINITQIEGQFPQAPYPKREQREEFVK
DWFQVPDDKFKQIFLDWEPRGEKSMPHYPTVDMCCDIVDWQERMHYIDDALGQCAGLSSF
PLKPPYHIHNYPKFIEAGAGIEMDEEKLTLAAKRYRTLVRAINIRRGMRRIDETPPANHW
KNRFPELEKELLDSYYKLKGWNDDGIPTKETLDELGLGFVSEEFVKRGILTD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgcagaaacagggtatgtattagaagttgatctgaccaagggaagcatcgag
agagtggcgacagatccgaaagacaccgagctgtatctgggcggattgggcaccaatgcc
aaactgctctgggaccgagtccctcctgaagttgatcctttttcgcccgacaatcttctc
atattcgctgcgggccttctgtgcggcacgccggctactgggtgcaaccggaccatcgtg
tccaccatttccccccagacccggctgatggctttttccatgatgggtgggttctgggcc
ccggaactgaaatatgccggttatgataaagtgatcctccgtggcaagtcccccgacctg
gtctatctttacatcaacaacgacaaggtggagattcgcgacgcctcccacctcaagggc
aaaggggctatcgaaacggcggagatcatcaagaaggagctggatgagccgcgggcccag
gtggcggccatcggtctggccggtgaaaaccgggtgtactatgcttccatcgagcagggt
cgctccagtgccagccgtggcggcatcggcgccgtcatgggggacaaaggggtcaaggcg
gtggtcgttcgcggcaccaaggatctttgtgtcgccaagccacaggagtatatggacctt
tgcaacgaggtgctcgattacatcaagcaccgggaggagaacccgatcccggacgtcatg
ccgattctggccgggctgggttcgccccaggagatgaaggtccacgacgagaagtggcat
acggagaacttcaactggggcaacgcccgtacccgccgcaaggatttctggaccgaagag
gtcgatcatgcctgggcggagaccatggagaaggcccggactcgcctgatcagctgctat
aactgccccatgaagtgcggcgcgaccatttccatggaggggcttcccacctacatgatg
aaatgcttcaccaagctcacctacaccatggctgcctattcggacctggatttcggtttg
aggatcgcccagaaggccacggagtacgggctggacggtttctccgctccccaggtcatg
gcctttgcctttgaactgttggaaaagggcatcctgacagaaaaagacttccctggtctg
cccgaggataacgaagagaagttcttctacctcttggacaagatcgtccggcgggatggg
attggcgatgtgctggccaacggcacctattgggcggcacaggagatcggcaagggggcg
gaagaatacgcccacaacaatatcaagaagcatgagcagctgccgctcaagctttccatg
ctgaaccccatctactacctcatgtattgcaccggggagaagatcaacatcacccagatc
gaggggcagtttccccaggcgccttatccgaagagagaacagcgggaagagttcgtcaag
gattggttccaggtgcccgatgacaaattcaagcagatcttcctggactgggagccgcgc
ggcgaaaagtccatgccccactatccgaccgtggacatgtgctgcgacatcgtcgactgg
caggagcggatgcattacatcgacgacgccctgggacagtgcgcgggtctctcttcgttc
cccctcaagcccccgtaccatatccacaactatcccaagttcattgaggctggggcaggg
atcgaaatggatgaagagaagctgaccctggcggccaagagataccggaccctggtcagg
gccatcaacatcagaaggggcatgagaaggatcgatgagacgccgccggcgaaccactgg
aagaaccggttccccgagctggaaaaggagttgctggattcgtactacaagctcaagggg
tggaatgacgacggcatccccaccaaggaaaccctggatgaactggggctgggttttgtc
agcgaggaattcgtcaagcggggcatcctgaccgattga

DBGET integrated database retrieval system