KEGG   Geobacter daltonii FRC-32: Geob_0243Help
Entry
Geob_0243         CDS       T00846                                 

Gene name
bamN
Definition
(GenBank) thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geob_0243 (bamN)
   00630 Glyoxylate and dicarboxylate metabolism
    Geob_0243 (bamN)
   00640 Propanoate metabolism
    Geob_0243 (bamN)
   00650 Butanoate metabolism
    Geob_0243 (bamN)
  Lipid metabolism
   00071 Fatty acid degradation
    Geob_0243 (bamN)
   00072 Synthesis and degradation of ketone bodies
    Geob_0243 (bamN)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Geob_0243 (bamN)
   00310 Lysine degradation
    Geob_0243 (bamN)
   00380 Tryptophan metabolism
    Geob_0243 (bamN)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Geob_0243 (bamN)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geob_0243 (bamN)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Geob_0243 (bamN)
Enzymes [BR:geo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Geob_0243 (bamN)
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geob_0243 (bamN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
299835..301010
Genome map
AA seq 391 aa AA seqDB search
MSEVFIVESLRTPLGSFGGALADVDAPRLAAAVIKELLERAALSPEAVDEVIIGQVLSGG
SGQAPARQALRYGGLPDSVPAMTINKVCGSGLKAIMLGADAIRLGDAHVVLAGGMENMSQ
APYALPKARNGFRMGNGEVVDLMVNDGLLDPYSGNHMGVIAEANAAKNGLSRAEQDEFAV
ASYKKAQAAVKDGVFKDEIVPVVKKGRQGEVVIAEDEEPLKGDIGKLPGLRAAFAKEGTI
TAGNASTINDGAGIALLASGEAVKKYNLKPKARLLAYATNSIHPDLFTEAPVGAIEKALV
KAGLKVGDIDLFELNEAFATVPLLAIKKLGIDPARVNVNGGAVAIGHPLGASGARLAATL
IRELHKRNARYGLATLCIGGGEAVAAIFERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtttttatcgttgagtcattgcgtacgccgctgggatcgtttggtggtgcg
cttgccgacgtggatgcgccgcgtctggctgctgcagtcatcaaggagctgctggagaga
gcggctctcagtcccgaagctgtggatgaggtgattatcggtcaggtgctttccggggga
agcggtcaggctcccgccaggcaggctctgcgttatggcggcctccccgactcggtaccg
gcaatgaccatcaacaaggtgtgcggcagcggcctgaaagcgattatgctcggggccgat
gcaatacgtctgggagacgcccacgttgtgctggccggcggcatggagaacatgtcccag
gcaccctatgccctgcccaaggcgaggaatggtttccgtatggggaacggtgaagtggtt
gacctgatggtcaatgacggcctgttggatccatacagcggcaaccatatgggggtcatt
gccgaggccaatgctgccaaaaacggcctgagccgtgccgagcaggatgaatttgccgtc
gcttcctataaaaaagctcaagcagcggttaaagatggcgtgttcaaagatgagatagtg
ccagtggtgaaaaaggggcgccagggggaggtggtgattgccgaggatgaagagccgctc
aagggtgatatcggcaagctgcccgggctgcgtgccgcatttgccaaagagggaaccatc
accgctggtaacgcatccaccatcaacgacggcgccgggatagccctgctggcatccggc
gaagcggttaagaaatacaacctgaagccgaaggcccgtttgctagcctatgccaccaac
agtattcatcccgacctctttaccgaggcgccggtgggagccattgaaaaagcattggtc
aaggcagggctcaaggtgggtgacatcgatctcttcgagctcaatgaggcctttgccacc
gtgccgcttttggctatcaagaagctgggcatcgatcctgcccgggtcaacgtcaacggt
ggagcggtcgccatcggccaccccctcggagcgagcggcgcacgcctggcagctaccctt
ataagggaactgcacaagaggaatgcccgttatggccttgccaccctttgcattggcgga
ggagaagcggtcgcagcgatttttgagcgggtatag

DBGET integrated database retrieval system