KEGG   Geobacter sp. FRC-32: Geob_0607Help
Entry
Geob_0607         CDS       T00846                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
geo  Geobacter sp. FRC-32
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Geob_0607
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Geob_0607
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Geob_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
672999..674120
Genome map
AA seq 373 aa AA seqDB search
MRKEILKKVKRVVIKIGSGVITSVDNGLDGDRIKGLAAEMAHFRQQGVEVVLVSSGAVAA
GRLELGLSDRPRTIPQKQAAAAIGQSKLMRAYEEEFACHGIKVAQLLLTRDDLASRPRFL
NARATIDTLLECGIIPIINENDTVVVEEIKFGDNDNLSALVTNLVEAQLLVILTDIDGFY
TADPRTNPEARLIHLVRSITKETERAAGGSGSSVGTGGMATKIAAAKKVGKSGIPTIMVN
GKKSGNLELVLAGTEVGTLFLPAGVSLNRRKHWIAYTQRPAGRVVVDNGAFRVLSQHGRS
LLPSGVVQVEGKFDRGACVRICTPDGTEFARGITDYSSREMELIAGHKSGDIEQILGYRY
GDDVIHRDNLVVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaaagagattctgaaaaaggtaaagcgcgttgtcataaagatcggcagtggtgtc
atcacttctgtggacaatggtcttgacggtgaccgcatcaagggactggcggccgaaatg
gcccattttcggcagcagggtgtcgaggtcgttcttgtttcatcgggcgctgttgcggcc
ggaaggctggagcttggattgtctgaccggccgcggaccatcccccagaaacaggcggcg
gcggcaatcggccagtcgaaactgatgcgagcctacgaagaggaatttgcctgccatggg
atcaaggtggcccaactgcttctgacccgtgacgacttggccagcagaccccgatttcta
aatgcccgggctaccatcgataccctgctcgaatgcggcatcattcccatcatcaacgag
aacgatacggtggtggtggaggaaataaaattcggcgacaacgataacctgtcggccctg
gtgaccaaccttgtcgaggcccagcttctggtgatcctcaccgatatagatggtttttat
accgcagacccccgcaccaatccggaggccaggctgattcacctggtccggtccattacc
aaggagacggagcgtgctgctggcggaagcggctcatccgtaggcaccggcggcatggcg
acaaaaatagccgctgccaagaaggtggggaaatcgggcattcccaccattatggtcaat
ggtaagaaaagcggtaatcttgaactggtgctggccggtacagaggtggggacgctgttt
ctgccggcaggggttagccttaatcggcgcaaacattggatagcctatacccagaggccg
gcgggccgggtcgttgtcgacaacggcgccttcagggtcctttcccagcatggcagaagc
ttgctgccgtcgggagtggtccaggtcgaggggaaattcgaccgtggcgcctgcgtcagg
atctgcaccccggacggcacagaattcgcccgtggcattaccgactattccagccgcgaa
atggagctgatagccggacataagagcggcgatatcgagcagatactgggatataggtat
ggggatgatgtgatacaccgcgacaacttggttgtactgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system