KEGG   Geobacter sp. FRC-32: Geob_0608Help
Entry
Geob_0608         CDS       T00846                                 

Gene name
proA
Definition
gamma-glutamyl phosphate reductase (EC:1.2.1.41)
Orthology
K00147  
glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
geo  Geobacter sp. FRC-32
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:geo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:geo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
674263..675519
Genome map
AA seq 418 aa AA seqDB search
MTVAEKIRKIAADARAASLAMARLSSAAKNELLLRMAEALENNAPLITAENARDLEAGQQ
KGLSAAMLDRLMLDESRIKAMADGLREVAALPDPVGEVTHMWKRPNEITVGKMRIPLGVI
GIIYESRPNVTSDAAALCLKAGNAVVLRGGSEAIHSNLAIAGLLQDQMRKLGIPVAALSL
IPFPERAGVTEMLKQEEFIDVIIPRGGESLIRFVVEHSKIPVIKHYKGVCHIFVDATADF
GMAEKIIINSKTQRPGVCNALETLLIHKDVAETFVPRIHEALSTLKVELRGDEAFRQFAP
GVKAATEEDWYAEYLELILAARVVDDLDEAIAHINKYGSLHTEAIITSDYANSQRFLREV
NSSVVLVNASTRFSDGNQLGLGAEIGISTTKLHSFGPMGLEDLTTTKFIVYGEGQIRQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccgaaaaaatacgaaaaatagctgctgatgcgcgggctgcctctttggcc
atggcccggctgtcttccgctgccaaaaacgagcttctgctcaggatggcagaggcttta
gagaacaacgcaccgcttattacggcggaaaatgccagggacctggaagcgggacagcaa
aaaggtctttcggccgccatgctggatcggctcatgttggatgagtcacgcatcaaggcc
atggcagatggtctgcgagaagtcgctgctctccccgacccggtgggagaggtgacacac
atgtggaagcgtcccaacgagatcaccgtcggcaagatgcgcattcctttgggggtcatc
ggcattatctacgagtcgcgccccaatgtgacctccgatgctgccgccctctgtcttaag
gcgggcaatgccgtcgttctccgcggcggatctgaggcgatccattcaaacctggccatc
gccggcctgctccaggaccagatgcggaagctgggtatcccggttgcggccctgtcgctg
attcctttcccggagcgggcaggggtgacggagatgctcaagcaggaggagttcatcgat
gtcatcattccccggggaggggagagcctgatcaggttcgtcgtcgagcactccaagatc
ccggtcatcaagcattataagggggtctgccatatcttcgtcgatgccacggccgatttc
ggcatggcggagaagatcatcatcaactcaaaaacccagcgaccgggagtgtgcaacgcc
ctggagaccctgctcatccacaaggatgttgccgagaccttcgtgccccgcatccatgaa
gcactctccaccttgaaggtggaactgcgcggcgacgaagcgtttcgccagtttgcccct
ggagtgaaagcagccaccgaagaggactggtatgccgagtacctggaactgatcctggcg
gccagggtagtggatgatctggatgaagcaatcgcccacatcaataagtacggttcgctg
catacggaagctatcattaccagcgattatgccaattcccagcggtttctgcgggaggtt
aactcaagcgtggtgctggtcaatgcctccacccggttctccgacggcaatcagcttggt
ctcggcgccgagatcggcatctccaccaccaagctccattctttcggccccatggggttg
gaagaccttacgacgaccaagttcatcgtttacggcgaaggacagataaggcagtga

DBGET integrated database retrieval system