KEGG   Geobacter sp. FRC-32: Geob_0689Help
Entry
Geob_0689         CDS       T00846                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
geo  Geobacter sp. FRC-32
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:geo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:geo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
761741..763030
Genome map
AA seq 429 aa AA seqDB search
MKFLDIRDNSFEDAFAAILARSEETGRDVEQIVVDIIAEVRSRGDAAVLDYTRRFDRLEA
DSVHSLEVTEVEFNEAFARVADEDIAALKLAVERVARFHQKQKQETWLSTDEPDIMLGQM
VTPLQRVGIYVPGGKASYPSSVIMNAVPAKVAGVGEVIMVAPTPGGEINPHVLVAARLSG
VDRVFRIGGAQAVAALAYGTATIPKVAKITGPGNIYVATAKKLVFGQVGIDMIAGPSEIL
VINDGSGNPAHIAADLLSQAEHDELASSILITTDRAFGERVAEEVELQLGQLSRESIARK
SWETYGAVIVSGSLPEAIDFSNRIAPEHLELAVTDPFAILPQIRNAGAIFLGHFTPEAAG
DYLAGPNHTLPTGGTARFFSPLSLDDFVKKSSIVYFSEGGLNRLGRSIVHIAQLEGLEAH
AKSVSKRLK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctcgatattcgcgacaattcctttgaagacgcttttgccgccatactcgcc
cgcagtgaggagaccggcagagacgtcgagcagatcgtagttgatattatcgctgaggtc
cgcagccgtggcgatgcggccgttcttgattatacccgccgctttgatcggcttgaagcc
gattcagttcattcgctggaagtaaccgaagtagaatttaatgaagcttttgcccgtgtg
gcagatgaagacatcgccgccctgaagctggcagtggaacgggtggcccgttttcaccag
aagcagaagcaggagacctggctttccacagacgagccggacatcatgcttggccagatg
gttaccccgctgcaacgggtaggtatctatgttcccggcggcaaggccagctacccctcc
agcgtcatcatgaacgcagtaccggccaaggttgccggggtgggtgaggtaatcatggtg
gcgccgacccccggcggcgagatcaatccccatgtgctggtggcagcgcgtctttccggt
gtggaccgggttttcaggattggcggtgcccaggcggttgctgcccttgcctatggcacg
gcaaccattccgaaagtggccaagatcaccggccccggcaatatttatgtggccacggca
aagaagctggtcttcggccaggtgggaatcgacatgatcgccggaccgtcggagatcctg
gtcatcaatgacggcagcggcaatcctgcccacattgcggcggatctcctttcccaggcg
gagcacgacgaactggcctcttccatccttattaccaccgaccgtgcttttggcgagcgg
gtggctgaagaggtggagttgcaattggggcagctgtcccgggaatccatcgcccgcaaa
tcctgggagacctatggcgcagtcatagtctccggcagccttccggaggccatcgatttt
tccaatcgcatcgctccggagcacctggaactggcggtaaccgatccgtttgccattttg
ccccagatccgcaatgccggtgccatcttcctcggccacttcacaccggaagcagcaggt
gattatctggccggcccgaaccacaccttgcccactggcggtacggcccgcttcttttca
ccgttgtctctggatgatttcgtcaagaagtcgtccatcgtttacttcagtgaaggaggc
ctgaacaggcttggtcggagcatcgtccatatcgcccagctggaaggcctggaagcacat
gccaaatcggtcagcaagcgattgaaataa

DBGET integrated database retrieval system