KEGG   Geobacter daltonii FRC-32: Geob_0909Help
Entry
Geob_0909         CDS       T00846                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Geob_0909 (folK)
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Geob_0909 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1004864..1005352
Genome map
AA seq 162 aa AA seqDB search
MKATAYIALGSNLGDRELNLLRGVAELGKLSRTQVTALSGFYQTEPVGGVPQADFYNAVA
RINTEHSPLELLDELQRIESGIFRRKKEAHWGPRPIDLDILFYNDEVITGERLTIPHPRL
HERRFVLQPLAEIAPDLVHPLLHKTIADLLAVLKAPERVEKL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgacggcttacatagctctcggatcaaacctgggagaccgggagcttaacctg
ctgcgtggggtggccgagctggggaaactttcccggacccaggtcacggccctttccggc
ttttaccaaaccgagcctgtcggaggagtaccccaggctgatttttacaatgcggtcgcc
aggataaacaccgagcattccccccttgaacttcttgacgagcttcagcgcatcgaatca
ggcattttcaggagaaagaaagaagcgcactggggcccccggccgattgatctggatatt
cttttctacaatgatgaagtaatcacaggtgaaagactgaccattccccatccacgactt
catgagcgacggttcgttcttcagcctcttgccgagatagctcccgacctggtgcatcca
ctactgcataaaacaatcgctgacctgctggctgtcctgaaggcgccggagcgggtcgaa
aaactctag

DBGET integrated database retrieval system