KEGG   Geobacter sp. FRC-32: Geob_1009Help
Entry
Geob_1009         CDS       T00846                                 

Definition
galactose-1-phosphate uridylyltransferase (EC:2.7.7.12)
Orthology
K00965  
UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
geo  Geobacter sp. FRC-32
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:geo00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:geo00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1102286..1103311
Genome map
AA seq 341 aa AA seqDB search
MSELRWDPLKLHWVIIATERGRRPRDFQAEPQEKEVASCPFCYGNEDKTPAEIFAIRPSG
PANSPGWKVRVIPNKYPVLRVEGEVKSKGYGVYDVMSGIGAHEVIIETPRHDQGLADLSP
SEITDVLKAYRTRYVDLRRDFRLRYMVLFKNHGIRAGATLAHSHSQLIAVPLTPPVAATE
LKICREFFESKERCIFCDLINFELESGSRIVKEFPNFVTMTPYASCFPFELRLYPKKHSH
DFALMDDAQLGELAIAMKDMLLRLKTVLKDPPYNFILHTAPPRQPRLGKPEYWGSIEYDY
HWHIELVPRLTQIAGFEWGTGFYINPTSPEDAAAFLREADI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattacgctgggaccccctgaaactgcactgggtcatcatcgccaccgagcgg
gggaggcggccgcgggattttcaggcggagccccaggagaaagaggtcgccagctgtccg
ttctgttacggcaacgaggacaagaccccggcggagattttcgccatccggccctcgggt
cctgccaactctcccggatggaaggtccgggtcattcccaacaaatacccggtgttgcgg
gtcgagggagaggtgaaaagcaaaggatacggtgtctatgacgtcatgtcgggcatcggc
gcccacgaggttattattgagaccccgcggcatgaccaggggctggcggatctttcgccg
tctgaaatcaccgatgtgctgaaggcttaccgtacccgttatgtggatctccgccgggat
ttcaggctccgttacatggtcctcttcaaaaatcacggcattcgtgcaggtgccaccctg
gcccattcccacagccaactcatcgccgttcctttgacgccgccggtcgcggccaccgaa
ctgaagatttgccgtgagtttttcgagagcaaggaacgctgcattttctgtgacctgatc
aattttgaattggaaagcggcagcagaattgtcaaagaatttcccaattttgtgactatg
accccgtatgcctcctgttttccctttgagctgcgcctgtatcctaaaaagcattctcac
gactttgccttgatggatgatgcccagctgggtgaactggccattgccatgaaggatatg
ctgctcaggttgaagacggtgctgaaggatcctccgtacaacttcattctccatacggct
cctccccggcagccgcgactcggcaagccggagtactggggttccatcgaatacgattat
cattggcatattgaactggtgccgaggctgacccagatcgccggttttgaatggggaacc
ggtttttacataaacccaacgtcaccggaggatgcagctgctttcctccgtgaggcagac
atttag

DBGET integrated database retrieval system