KEGG   Geobacter sp. FRC-32: Geob_1206Help
Entry
Geob_1206         CDS       T00846                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
geo  Geobacter sp. FRC-32
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Geob_1206
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Geob_1206
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Geob_1206
Enzymes [BR:geo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Geob_1206
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geob_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1315771..1317387
Genome map
AA seq 538 aa AA seqDB search
MLEILRKRRSIISLVVTVQLILSLAGCGTTDTIGGAKNVILVVADGMQLEHERAAGNYLY
GAPEGALQHQKYNYKGAASTWDVTTYNRYAFAAYSSNGFSSRRYSDATVNLDNLATFDPA
LGYNPAKGGKLPYRQDTTGQTGYFGTKIKDSSTGTAKYPATDSASAGTALATGFKTDDGN
IAWRSGDPANGRLASIAEMYRNQKKASIGVVSTVPFSHATPAAFVSHNTNRNNYQAIAQE
IITVSRPEVVIGGGNPNFNDPAGITGPAAYQYVDAADYAALKGSTEYTFIERKAGVDGGT
ALSGAADAAAAGNKKLFGLFGGAGGSFEYHKPSNDGTSQITRGSIENPTLADAAKAALKV
LGKNRNGFFLMVEQGDIDWSNHANDYASMIGGIWDLNEAIKSIEAYVDQSGDDVTWDNTM
LIVTSDHGNSYMRLAKDLAKGSLPKQNPISDGGAPAGYDSSVGYYYDPTEVTYGFAGKGV
NSHSNELVTLYGKGAGLSQLSAYQGLWYPGTTIVDNTQIFKAMLGALGLIDDNRIKAN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattttgcgcaaaagaagaagtatcatctccctggttgtcacggtccaattg
atactgtccttggccggatgcggaacgacggacacgatcggcggggcgaaaaacgtcatc
ctggttgtcgcagacggcatgcagctggagcacgaacgggctgcaggcaattacctttat
ggcgcgcccgagggggctttgcagcaccagaagtacaactacaagggggcagcttccact
tgggacgtgaccacctacaaccgctatgcctttgcggcttattccagcaacggtttcagc
agcaggcgctacagcgacgctaccgtcaatctggacaatcttgcaaccttcgaccccgcc
ctcggctataatcctgcaaaagggggaaaactgccctatcgccaggataccactggtcag
accgggtatttcggcaccaaaataaaggacagcagtaccggcactgccaaatatcccgca
acagactcggcgtcggcaggcacggcactggcgaccgggttcaaaaccgatgacggcaac
atcgcctggcgtagcggcgatccggccaacggccgacttgccagcatcgccgaaatgtat
cgcaaccagaagaaggcatccatcggcgtcgtcagcacggtacccttttcccacgccact
ccggccgcttttgtcagccataacaccaaccgcaacaactaccaggccatagcccaggag
atcatcaccgtgtcccgtccggaggtggtcattgggggcggcaaccccaacttcaatgat
ccggcagggattaccggacccgctgcttaccagtatgttgatgctgccgattatgccgcg
ctgaaaggttcgaccgaatacactttcatcgagcgtaaggcgggtgttgacggcggaaca
gccctgtccggcgcggcagatgctgcggcggcaggaaacaagaagttgttcggactcttc
gggggcgcgggagggagtttcgaataccataaaccaagtaatgacggtacttcgcagatt
acccgtggttccattgaaaatcccacccttgccgatgctgccaaggcagcacttaaagtg
ctcggcaagaatcggaacggcttttttctcatggtggagcagggggacatcgactggtcc
aaccatgccaacgattatgcttccatgatcggcggcatctgggacctgaacgaggcgatt
aaatccatcgaagcctacgtggatcaatccggggatgatgtgacctgggataacaccatg
cttatcgtcacctcggaccatggcaacagttatatgcgtttggcgaaagacctggccaaa
gggagcttgccgaagcagaaccccatcagtgacggcggcgctccggccggctatgacagt
tccgtcggctattattacgatccgacggaggtgacctatggctttgcaggcaaaggggtc
aactcccattccaacgagctggtgaccctctatggtaagggcgccgggctgtctcagctc
tccgcctatcaggggctctggtatccggggacgaccattgtcgacaacacccagattttc
aaggccatgctgggtgcactgggactgatcgacgacaaccgcatcaaggccaactga

DBGET integrated database retrieval system