KEGG   Geobacter daltonii FRC-32: Geob_1247Help
Entry
Geob_1247         CDS       T00846                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Geob_1247
Enzymes [BR:geo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Geob_1247
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geob_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1365401..1366414
Genome map
AA seq 337 aa AA seqDB search
MFYPTFRARRIRSKEVFRNMVRETALSTNDLIYPMFSAFGKGIRKEISSMPGIYQQSIEN
IVEEAQEAYELGVPAVILFGIPETKDAVGSDAYAEHGIIQETIRALKKEVPKLAVITDVC
MCEYTDHGHCGIIKNGDVDNDETLELLAQEALSHAQAGADMVAPSDMMDGRVMAIRETLD
NNGYKHIPVMSYAVKYASGYYGPFREAAESTPQFGDRRSYQMDPANRLEAVREAQMDVEE
GADIIMVKPGLPYLDVVREMRNQFNLPVAVYNVSGEYSMIKAAGKMGWIDEDRVTMETML
SFKRAGADLILTYHAKEVATLLHKGYEIDRASRCGCP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttctatcccacgttccgtgcccgtcgcatcagaagcaaagaagtcttccgtaacatg
gtccgcgagaccgctctttctaccaatgacctgatctaccccatgttttcggccttcggc
aaggggataaggaaggaaatttcctccatgccgggcatctatcagcaatcaatcgagaac
atcgtcgaggaagcccaggaggcctatgaattgggggtgcctgcagtgatcctcttcggc
attccggaaaccaaggatgcggtgggaagcgacgcctatgcagaacacggtatcatccag
gagacgatccgcgccctgaaaaaagaggtgcctaaactggcggtaatcaccgacgtctgc
atgtgcgagtacaccgaccacggccactgtggcatcatcaagaatggtgatgtggacaat
gacgagaccctggaactgctggcccaggaagcactttcccatgcccaggccggcgccgac
atggtggctccttccgacatgatggatggtcgggtgatggccatccgcgagacgctggac
aacaatggttacaagcatattccggtgatgagctatgccgttaaatacgcctcgggctat
tacggtccgttccgcgaggcggccgaatccaccccccagttcggcgaccgccgttcctac
cagatggaccctgccaatcgtcttgaggctgtgcgtgaggcccagatggatgtggaggag
ggcgccgacattatcatggtcaagcccggccttccctacctggatgtagtccgggagatg
cgcaaccagttcaacctgccggttgctgtgtacaatgtatcgggcgaatacagcatgatc
aaagcagcaggcaagatgggctggatcgacgaggaccgggtaacaatggaaaccatgctc
tccttcaagcgtgccggtgctgacctcatcctgacctatcacgccaaggaagtggcaacg
ctgttgcacaaggggtatgagattgaccgtgcctcccgctgcggttgcccttaa

DBGET integrated database retrieval system