KEGG   Geobacter daltonii FRC-32: Geob_1388Help
Entry
Geob_1388         CDS       T00846                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:geo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Geob_1388 (recD)
Enzymes [BR:geo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Geob_1388 (recD)
DNA repair and recombination proteins [BR:geo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Geob_1388 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 UvrD-helicase DUF2075 AAA_22 PhoH AAA_16 UvrD_C AAA_24 PIF1
Motif
Other DBs
NCBI-ProteinID: ACM19748
JGI: Geob_1388
UniProt: B9M4M2
Position
complement(1534199..1536028)
Genome map
AA seq 609 aa AA seqDB search
MNREEGMGPVAEIMPFSDMDRHFAAFMCRLASSDDKELWLAAALASQAVSNGNVCLDLTD
VCQSAAGYEIDDPAAWSARLRELPVVGAPGDFTPLVLDSANRLYLHRYWSYESDLARALL
RLADNKPVFDRELLREGMSRLFPEGNAGETDWQQLAALACVSRQITVIAGGPGTGKTSTV
FRVLILLIEQATAGKCHIALAAPTGKAAGRLGESIISARSGMPVSEHVLQQIPNQVTTIH
RLLGHVPGSSRFRYNRDNPLPFDVVVVDEASMVSLPLMAKLVDALRDTTRLILLGDRDQL
ASVEAGAVLGDICNTGSSQRLSKAFRDLAEEVIGPGAAIEYADDADVHHLNDSIIVLRKS
YRFGADSGIGELGRLVNEGNGAAALELLSGQKYADLLFRENTGMEKLQEALAVTITDGFR
PYLMAKTAESAFASLADFRILCALRQGPFGTEAVNRLVAKILAEKGLIRPHGRWYAGQPV
MVTRNDYNLRLFNGDIGIILPDPAADNELRAFFTTTDGSLRSILPLRLPEHETAFAMTVH
KSQGSEFSRILLLLPDRHSEVLTRELIYTALTRAKTGVEVCGPGDVFVKSSARRTLRKSG
LREALWGKL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaacagggaggaaggaatgggcccagtggccgagatcatgccatttagcgatatggac
agacactttgccgccttcatgtgtcgcctggcttccagcgatgataaagagctgtggctt
gcggccgcccttgccagtcaggccgtcagcaatggcaatgtctgcctcgacctgacggat
gtctgccaatctgctgcaggttacgagatcgatgacccggcagcatggtccgcccggctc
agggagttgccggtggtgggtgcaccgggggattttacccccctggtcctcgacagcgcc
aaccgtctctacctccaccgctactggagctatgaaagcgacttggcccgagcattactt
cgtcttgccgacaataagccggttttcgaccgggaattgctcagggagggtatgagccgc
ctgtttccggagggcaacgctggtgaaacagactggcagcagctcgcagcgctggcctgc
gtcagcaggcaaattaccgttattgccggggggcctggaacgggaaagacctccactgtt
ttccgggtcctgatcctgctcatcgagcaggccaccgccggaaaatgccacattgccctg
gccgcccccaccggcaaggcagcgggaagacttggtgaatcgataatctcggcaagaagc
gggatgcccgtcagtgagcatgtgctgcaacagatccccaaccaggtcacgaccatccat
cggctcctggggcacgtgccgggctcaagccgcttcaggtacaaccgggacaatcccctc
cccttcgatgtggtggtggtggacgaagcatcaatggtctcgctgccgctgatggcaaaa
ctggttgatgcgctgcgggacacaacccgcctcatcctgctgggagatcgggatcagctg
gcctcggtggaagcaggggccgttttgggcgacatctgcaacaccggcagcagccaacgt
ttgtccaaagccttccgtgatctggcagaggaggtaatcggccctggggcagcaattgaa
tatgctgacgatgccgatgttcaccatctgaacgatagcatcatcgtcctgcgcaaaagc
tatcgttttggcgccgacagcggtatcggagaactgggcagactggtcaatgaagggaat
ggcgctgcagccctggagctgctgagtgggcaaaaatacgcggacctcctttttcgtgaa
aataccggcatggagaaacttcaagaagcgctggctgtcaccataaccgatggttttaga
ccgtacctgatggcgaaaacggcagagagcgcctttgcctcattggccgatttccgcatt
ctgtgtgctctgcggcagggaccgttcggcacagaggcagtaaatcggcttgtagcaaaa
atcttggccgaaaaaggcctgattcgcccccatgggcgctggtatgcaggccagccggtc
atggtgacgaggaatgattacaacctccggcttttcaatggcgacatcggcattattctg
cctgacccggcagcagacaacgaactgcgtgcctttttcaccacaacggacggttcactc
aggtcaatactacccctgcgccttcccgaacatgagaccgccttcgccatgaccgttcac
aagagccagggctccgaattcagcagaattttgctgctgctgcccgaccggcattcggag
gtcctcacccgggaactcatctacacggctcttaccagggccaagacaggagtagaagta
tgcggtccgggtgatgttttcgtcaaaagctcggcacgtaggacgctacgtaaatccggc
ttgcgcgaagcactatggggcaagctttaa

DBGET integrated database retrieval system