KEGG   Geobacter sp. FRC-32: Geob_1388Help
Entry
Geob_1388         CDS       T00846                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
geo  Geobacter sp. FRC-32
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:geo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Geob_1388
Enzymes [BR:geo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Geob_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1534199..1536028)
Genome map
AA seq 609 aa AA seqDB search
MNREEGMGPVAEIMPFSDMDRHFAAFMCRLASSDDKELWLAAALASQAVSNGNVCLDLTD
VCQSAAGYEIDDPAAWSARLRELPVVGAPGDFTPLVLDSANRLYLHRYWSYESDLARALL
RLADNKPVFDRELLREGMSRLFPEGNAGETDWQQLAALACVSRQITVIAGGPGTGKTSTV
FRVLILLIEQATAGKCHIALAAPTGKAAGRLGESIISARSGMPVSEHVLQQIPNQVTTIH
RLLGHVPGSSRFRYNRDNPLPFDVVVVDEASMVSLPLMAKLVDALRDTTRLILLGDRDQL
ASVEAGAVLGDICNTGSSQRLSKAFRDLAEEVIGPGAAIEYADDADVHHLNDSIIVLRKS
YRFGADSGIGELGRLVNEGNGAAALELLSGQKYADLLFRENTGMEKLQEALAVTITDGFR
PYLMAKTAESAFASLADFRILCALRQGPFGTEAVNRLVAKILAEKGLIRPHGRWYAGQPV
MVTRNDYNLRLFNGDIGIILPDPAADNELRAFFTTTDGSLRSILPLRLPEHETAFAMTVH
KSQGSEFSRILLLLPDRHSEVLTRELIYTALTRAKTGVEVCGPGDVFVKSSARRTLRKSG
LREALWGKL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaacagggaggaaggaatgggcccagtggccgagatcatgccatttagcgatatggac
agacactttgccgccttcatgtgtcgcctggcttccagcgatgataaagagctgtggctt
gcggccgcccttgccagtcaggccgtcagcaatggcaatgtctgcctcgacctgacggat
gtctgccaatctgctgcaggttacgagatcgatgacccggcagcatggtccgcccggctc
agggagttgccggtggtgggtgcaccgggggattttacccccctggtcctcgacagcgcc
aaccgtctctacctccaccgctactggagctatgaaagcgacttggcccgagcattactt
cgtcttgccgacaataagccggttttcgaccgggaattgctcagggagggtatgagccgc
ctgtttccggagggcaacgctggtgaaacagactggcagcagctcgcagcgctggcctgc
gtcagcaggcaaattaccgttattgccggggggcctggaacgggaaagacctccactgtt
ttccgggtcctgatcctgctcatcgagcaggccaccgccggaaaatgccacattgccctg
gccgcccccaccggcaaggcagcgggaagacttggtgaatcgataatctcggcaagaagc
gggatgcccgtcagtgagcatgtgctgcaacagatccccaaccaggtcacgaccatccat
cggctcctggggcacgtgccgggctcaagccgcttcaggtacaaccgggacaatcccctc
cccttcgatgtggtggtggtggacgaagcatcaatggtctcgctgccgctgatggcaaaa
ctggttgatgcgctgcgggacacaacccgcctcatcctgctgggagatcgggatcagctg
gcctcggtggaagcaggggccgttttgggcgacatctgcaacaccggcagcagccaacgt
ttgtccaaagccttccgtgatctggcagaggaggtaatcggccctggggcagcaattgaa
tatgctgacgatgccgatgttcaccatctgaacgatagcatcatcgtcctgcgcaaaagc
tatcgttttggcgccgacagcggtatcggagaactgggcagactggtcaatgaagggaat
ggcgctgcagccctggagctgctgagtgggcaaaaatacgcggacctcctttttcgtgaa
aataccggcatggagaaacttcaagaagcgctggctgtcaccataaccgatggttttaga
ccgtacctgatggcgaaaacggcagagagcgcctttgcctcattggccgatttccgcatt
ctgtgtgctctgcggcagggaccgttcggcacagaggcagtaaatcggcttgtagcaaaa
atcttggccgaaaaaggcctgattcgcccccatgggcgctggtatgcaggccagccggtc
atggtgacgaggaatgattacaacctccggcttttcaatggcgacatcggcattattctg
cctgacccggcagcagacaacgaactgcgtgcctttttcaccacaacggacggttcactc
aggtcaatactacccctgcgccttcccgaacatgagaccgccttcgccatgaccgttcac
aagagccagggctccgaattcagcagaattttgctgctgctgcccgaccggcattcggag
gtcctcacccgggaactcatctacacggctcttaccagggccaagacaggagtagaagta
tgcggtccgggtgatgttttcgtcaaaagctcggcacgtaggacgctacgtaaatccggc
ttgcgcgaagcactatggggcaagctttaa

DBGET integrated database retrieval system