KEGG   Geobacter sp. FRC-32: Geob_1565Help
Entry
Geob_1565         CDS       T00846                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
geo  Geobacter sp. FRC-32
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:geo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1726145..1726984
Genome map
AA seq 279 aa AA seqDB search
MKTIECKAPAKVNYRLDVLRRRPDGYHDLRMIMQRIDLCDDIRISLSETPGVRVACGKEG
VPDGPGNIAWRAADALLKLSGRCTGIDISIVKNIPVAAGLGGGSSDCASALMGVNELLEL
HLTDEQLMEAGSKLGADVPFFIFKKTALAEGIGDKLAAVEAAPAWLVIVNPNLAVSTAWV
YQNLQLTAGKDEYIIPRFYGSVSDICAILANDLEKVTIGRFPVINQIKQKLLQVGAAGSL
MSGSGSTVFGIFAEEAPARKAAEKLSRESDWFVAAVKTL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgaatgtaaagctccggcaaaggtcaattaccgtttggatgtcctgcgc
cggcggccggacgggtaccatgacctgcgcatgattatgcagcgtatcgacctctgtgat
gatatccgcatttctctgtcggaaactcccggagtgcgggtggcctgcggcaaagagggg
gtgcccgatggaccgggcaatatcgcctggcgggctgccgatgcgttgctcaagctttcg
gggcgatgcacaggcatcgacatcagcatcgtcaagaacataccggtggctgccggtctt
ggtggcggcagcagcgactgtgcctctgccctgatgggggtgaacgaactccttgaactg
catctgaccgatgaacagctgatggaggcagggagcaagcttggtgccgacgttccattt
tttatcttcaaaaagacggcccttgcagaggggataggcgataagcttgctgccgttgag
gctgcccccgcatggctggttatcgtcaatcccaatctcgctgtatccaccgcatgggta
taccaaaatttgcaattgacagccggaaaagatgaatatataattcctcgcttctatggg
agtgtctcggatatctgcgcgatccttgccaacgacctggagaaggttaccatcggcagg
tttcccgtcataaaccagatcaagcagaagctgctccaggtgggcgcagccggctcgctt
atgtccggcagtggctccacagtcttcggcatcttcgcagaagaagcccccgcccgaaag
gcggcggaaaagctttccagggagagcgactggttcgtagctgcggtcaaaacactgtaa

DBGET integrated database retrieval system