KEGG   Geobacter daltonii FRC-32: Geob_1802Help
Entry
Geob_1802         CDS       T00846                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00040  Pentose and glucuronate interconversions
geo00052  Galactose metabolism
geo00500  Starch and sucrose metabolism
geo00520  Amino sugar and nucleotide sugar metabolism
geo01100  Metabolic pathways
geo01130  Biosynthesis of antibiotics
Module
geo_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Geob_1802 (galU)
   00052 Galactose metabolism
    Geob_1802 (galU)
   00500 Starch and sucrose metabolism
    Geob_1802 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Geob_1802 (galU)
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Geob_1802 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACM20160
JGI: Geob_1802
UniProt: B9M772
Position
1992339..1993214
Genome map
AA seq 291 aa AA seqDB search
MQVKKAVFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRSK
RAIEDHFDISFELESLLYDKGKDAELSQIRDIAEMMNIFYVRQKQALGLGHAILCAKEFI
GNEPFAVLLGDDIIDGKKPCLGQLLEVYRKYRGPVLALEQVPMENISSYGCVAANTISDR
IYEVVDMVEKPKQEDAPSDLAIIGRYILTPDIFPILEKQEPGKGGEIQLTDAIKKLAKDE
AIYGCRFEGIRHDCGDKLGFLKATVDMALKREEFNGDFERFLRERLDCVKR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaaaaaagcagtatttcccgttgccgggcttggcaccaggtttcttcccgca
acaaagtccaccccaaaagagatgctccccctgattgacaagcctctggtgcagtatgtg
gttgaagaggcggttgcctcgggcatcgaacagatactcttcgtcaccggcaggagcaag
cgggctattgaggaccatttcgacatctctttcgagctggaatcactgctgtacgacaag
gggaaggacgctgaactcagccagatcagggatattgccgagatgatgaatatcttctac
gtgcggcagaaacaggcactcggtcttggccatgccatcctctgcgccaaggaattcatc
ggcaacgaaccctttgccgttctgctgggtgatgacatcatcgacggcaaaaaaccatgt
ctgggacaactgctggaggtctaccgcaagtatcgcgggccggtcctggcgctggaacag
gtgcccatggagaatatctcttcctatggctgtgtcgccgccaacactatctcggaccgg
atctacgaggtggtggatatggtggaaaagccgaagcaggaggatgccccgtccgatctg
gcgataatcggccgctacattctcaccccggatatcttccccattcttgaaaaacaggag
ccgggcaaggggggagagatccagcttaccgatgccataaagaaactggcaaaggatgaa
gctatttacggctgccgtttcgaaggcatccgccatgactgtggcgacaagctgggcttt
ctcaaggccacagttgatatggccttgaagcgggaggaattcaacggcgacttcgagagg
ttcctgcgggaacggctggactgcgtcaaacggtga

DBGET integrated database retrieval system