KEGG   Geobacter daltonii FRC-32: Geob_1802Help
Entry
Geob_1802         CDS       T00846                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Geob_1802
   00052 Galactose metabolism
    Geob_1802
   00500 Starch and sucrose metabolism
    Geob_1802
   00520 Amino sugar and nucleotide sugar metabolism
    Geob_1802
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Geob_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1992339..1993214
Genome map
AA seq 291 aa AA seqDB search
MQVKKAVFPVAGLGTRFLPATKSTPKEMLPLIDKPLVQYVVEEAVASGIEQILFVTGRSK
RAIEDHFDISFELESLLYDKGKDAELSQIRDIAEMMNIFYVRQKQALGLGHAILCAKEFI
GNEPFAVLLGDDIIDGKKPCLGQLLEVYRKYRGPVLALEQVPMENISSYGCVAANTISDR
IYEVVDMVEKPKQEDAPSDLAIIGRYILTPDIFPILEKQEPGKGGEIQLTDAIKKLAKDE
AIYGCRFEGIRHDCGDKLGFLKATVDMALKREEFNGDFERFLRERLDCVKR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaaaaaagcagtatttcccgttgccgggcttggcaccaggtttcttcccgca
acaaagtccaccccaaaagagatgctccccctgattgacaagcctctggtgcagtatgtg
gttgaagaggcggttgcctcgggcatcgaacagatactcttcgtcaccggcaggagcaag
cgggctattgaggaccatttcgacatctctttcgagctggaatcactgctgtacgacaag
gggaaggacgctgaactcagccagatcagggatattgccgagatgatgaatatcttctac
gtgcggcagaaacaggcactcggtcttggccatgccatcctctgcgccaaggaattcatc
ggcaacgaaccctttgccgttctgctgggtgatgacatcatcgacggcaaaaaaccatgt
ctgggacaactgctggaggtctaccgcaagtatcgcgggccggtcctggcgctggaacag
gtgcccatggagaatatctcttcctatggctgtgtcgccgccaacactatctcggaccgg
atctacgaggtggtggatatggtggaaaagccgaagcaggaggatgccccgtccgatctg
gcgataatcggccgctacattctcaccccggatatcttccccattcttgaaaaacaggag
ccgggcaaggggggagagatccagcttaccgatgccataaagaaactggcaaaggatgaa
gctatttacggctgccgtttcgaaggcatccgccatgactgtggcgacaagctgggcttt
ctcaaggccacagttgatatggccttgaagcgggaggaattcaacggcgacttcgagagg
ttcctgcgggaacggctggactgcgtcaaacggtga

DBGET integrated database retrieval system