KEGG   Geobacter sp. FRC-32: Geob_1875Help
Entry
Geob_1875         CDS       T00846                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
geo  Geobacter sp. FRC-32
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:geo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:geo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2092252..2093997
Genome map
AA seq 581 aa AA seqDB search
MYMFGWTGKILKVDLTSGRCWREDISLELLHSYLGGRGLGVRLMRDHFHLDPFDPQMPLI
FAVGPLCGTSAPTAARLAVVSRSPLTGTIYDCSAGGRFAWRFKAAGIDALFITGQSSQPV
VLSIADEKVELRAADHLWGQTVHQAMSALGAGGSTACIGPAGENGVLYANIMMGEGNSVG
RGGLGAVMGKKRLKGIVVEGSKSTAVFDQARFDHARQDVMRLFRASPVIFGELGIGEYGT
PALVDLMRQRRMAPTENFSKTFFAESGNYSGPAIRKACAAKKDGCYGCPIQCKKSTPNGE
HLPEYETVSHFGGLNGIADLHAIVKANTLCNELGLDTITAAATLSAWGEIRGRFPIAEEI
PQLLQDIACRCHDGELLSLGSRRVAEALGRPELSMSVKSLELPAYDPRGAYGMALAYCTS
NRGGCHLRAYPISHEILRKPVPTDRFSFSGKARIIKIAEDTNAAVDSLVACKFSFFGATL
EEYAEFVTATTGVEYTPQSLKETGERIYLTERFYNCANGFTAVDDFLPDRFYSEPGSSGD
GIDIHPIDRDRFHGEMQKYYRIRGLTEDGTFADSNFLERLP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgtttggttggaccggaaaaattttaaaagtagacttgaccagtggccgttgc
tggcgtgaagatatctctctggaactgctccattcctatctgggtgggcgggggctgggg
gtgcggttgatgcgggatcactttcacctggatccgtttgacccgcagatgccgttgatc
tttgccgttgggccactgtgcggcacctctgcccccacggcggcaagactggctgtcgtc
tcccggtcgcctcttaccggcaccatttatgattgttcggctggaggacgctttgcctgg
cgcttcaaggccgcagggatcgatgccttgttcataacgggccagagcagccagccggta
gtgctttccattgctgacgagaaggttgagcttcgggctgctgaccacctttgggggcag
acggttcatcaagccatgtctgcgctgggggcaggaggcagcactgcctgtatcggcccg
gccggagagaatggcgtcctttatgccaacatcatgatgggggaagggaattcagtcggc
cgaggcggcctcggggcagtgatgggcaaaaagcggctgaagggtattgtcgtagagggc
agtaaatctactgcggtctttgatcaggcccgtttcgaccacgcccgccaggatgtgatg
cgcctttttcgagcttctccggtcatcttcggcgaactgggcattggtgaatacggcact
ccggccctcgtggacctgatgcgccagcggcgcatggctccaaccgaaaacttcagcaag
accttttttgccgaatcggggaactattcaggacctgccatccgcaaagcttgtgccgca
aaaaaggacggctgctatggctgccctatccagtgcaagaagagcactccgaacggggag
catcttcccgagtacgaaacggtttcccattttggcggtctaaatggcattgccgatctc
cacgccatcgtcaaggcaaataccctctgcaacgagctgggtctggataccataaccgct
gctgccaccctgtctgcatggggagagattcgtggcaggttccccatagcagaggaaatt
ccccagcttctccaagacattgcctgccgatgccatgacggggaactcctttccttaggc
tcgcgccgggtggcagaagcactgggccggccggagttgtccatgtcggtcaagtccctg
gaactgccggcctatgacccccgcggtgcctacggcatggcgcttgcctactgcaccagc
aatcgcgggggctgccatctgcgcgcctatcccatctcccacgaaattctgaggaagccg
gtccccaccgaccgcttctccttctcgggcaaggcacggatcatcaagatcgccgaagat
accaatgctgctgtcgattccctggttgcctgcaagttctcctttttcggcgccaccctg
gaagaatacgcagagtttgtgaccgccacaaccggcgttgaatatacgccccagtcactg
aaggaaacaggggagcgcatctatttgaccgaacgattctataactgcgccaacggcttt
accgcagtggatgatttccttccggaccggttctacagtgagcccggctccagtggtgat
ggaatcgacattcatccgatcgaccgggaccgtttccatggggagatgcagaaatactac
cggattcgtggcctgacagaagacgggacctttgctgattcgaattttctggagcgtctg
ccttga

DBGET integrated database retrieval system