KEGG   Geobacter sp. FRC-32: Geob_1889Help
Entry
Geob_1889         CDS       T00846                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
geo  Geobacter sp. FRC-32
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Geob_1889
Enzymes [BR:geo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Geob_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2108306..2109799
Genome map
AA seq 497 aa AA seqDB search
MQRRRKSGILLHPSSLPGPGGIGSLGADAYRFVDFLQQAGQTMWQILPLGPTAYGNSPYS
CYSAFAGNPLLISLESIIDDGDVDSKDLKPNLPSGRVDYSLVQPYKLGVLRKAASRFFET
ADQRRKDDFWYFCDNTFWLHDHALFMALKEHYSGKSWCDWPEDIALRKPEAVAEHSEKLG
TAIGEHKYMQWQFFRQWQRLKSYTNDRHIEIIGDMPIFVAFDSTDVWANPHLFHLDKKGR
PTLVAGVPPDYFSKTGQLWGNPLYNWERVAEEGFSWWVARVRNDLSLYDRVRIDHFRGFE
AYWEVPAGEKTAKNGRWIKGPGDALFYALASQLGPVPLIAEDLGVITPEVEALRDKFGFP
GMKILQFAFGSGPSNPYLPHNHVQNCAVYTGTHDNDTTSGWFALLKEKEKQDILCYLNIG
AENISWDFVRSTLASVADMAIFPLQDILGLDSEARMNIPGVAGGNWSWRFSAEMLDNGVA
KRLKALTEMYGRGRSNL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaagaagaaaaagcggcatcctccttcatccgtcttctttgccgggaccaggc
ggtatcggttctctgggtgcggatgcgtacagatttgtagattttttgcagcaggctggc
cagacaatgtggcagatattgcccttgggaccgacagcctatgggaactctccctattcc
tgctattctgcatttgccggcaatccattgctcatttcactggaatcaattattgatgac
ggcgatgtggattccaaggacctgaagccaaacctgccaagcgggcgtgtagattatagt
ctggttcagccgtataaacttggtgtcctgcgtaaagctgcgtctcgcttttttgaaaca
gctgaccagcggcgtaaagatgatttctggtatttctgcgacaataccttctggctgcat
gaccatgcgctgtttatggcgctcaaggagcactactccggcaaaagctggtgcgactgg
ccggaagatattgccctgcgcaagcctgaagccgtggcagaacactcagaaaagctcgga
acggccatcggtgaacataaatacatgcaatggcagtttttccggcaatggcagcgcctc
aaatcctataccaacgacaggcatatcgagatcatcggcgatatgcccatttttgttgcc
tttgactcaaccgatgtatgggccaatcctcacctgtttcacctggacaaaaagggaaga
ccaacgctggttgccggcgtcccccccgattatttcagcaagaccggtcagctgtggggc
aatcccctttacaactgggaaagggttgccgaagaaggttttagctggtgggtggcacgg
gtgcgaaatgatttgtctctttacgaccgggtcaggatagatcacttccgtggatttgaa
gcttactgggaggtgccggcgggagaaaaaacggcaaaaaacggacgttggatcaagggg
ccgggcgatgcactcttttatgccctggccagccagttgggtccagttccgcttattgcc
gaagacctgggggtcataacgcccgaggtggaggcactcagggacaagttcggatttccc
ggaatgaaaatccttcagtttgcattcggctccggaccatcgaatccgtatctgccccac
aatcacgtgcagaactgcgccgtctataccggaacccatgacaatgacacgacatccggc
tggtttgctttacttaaggaaaaagaaaaacaggatatactttgctatctcaatatcggg
gccgagaacatcagctgggattttgtcagatctaccctggcatcggtagctgatatggcc
atcttcccgctacaggacatattaggtctggacagcgaagcgcgcatgaatattcccggt
gtagcgggaggcaattggtcatggcgattttctgcggagatgctggacaatggcgtggcc
aaacggctcaaggctttgacggaaatgtatggaagaggcagaagcaatctgtag

DBGET integrated database retrieval system