KEGG   Geobacter daltonii FRC-32: Geob_1949Help
Entry
Geob_1949         CDS       T00846                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geob_1949
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geob_1949
  Amino acid metabolism
   00310 Lysine degradation
    Geob_1949
Enzymes [BR:geo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Geob_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2183240..2184424
Genome map
AA seq 394 aa AA seqDB search
MEIKVPAVGESITEALVAKWHKGDGERVEKDEVLCEIETDKITLEINADASGTLAIRAKE
GETVQIGAVIGTIDEKGAAGQASGPAKPSGPEKEKTEPQPPLSPAVRKMAQEKGIKAETI
KGSGKGGRVTVDDLLKQQPEPSPQPTLFVRSEEPAPYQTVEESRITRKKMTPIRRKIAER
LLAARQQTAMLTTFNEVDMGRIMELRRQHKEHFQKKFGVTLGFMPFFIKACIDALREFPM
VNARIDGDEIVQQHFYDMGIAIGGEKGLVVPVIRDADRLTLVEMEKKIRSLVEQVENNRL
SLEDLTGGTFTISNGGVYGSMLSTPILNPPQSGVLGMHAIQDRPVARDGQVVIRPMMYLA
LSYDHRIIDGREAVGFLKRVKEYVEDPEEMLLEG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaagttccggcagtgggggaatcgatcaccgaggcgctggttgccaagtgg
cacaagggggatggcgagcgggtggagaaggatgaggtcctctgcgagatcgagaccgac
aagatcaccctggagatcaatgcagatgcttccggaacccttgccatccgggcaaaggaa
ggggaaacggtgcagattggcgctgtcatcggcaccattgatgaaaaaggtgcggcaggg
caggcctctggcccggcgaagccatcaggcccggaaaaggaaaaaacagagccgcagccg
ccgctttctccggcggtgcggaagatggcccaggaaaagggaataaaggctgaaaccatc
aaggggagcggcaaggggggcagagtaacggtggacgacctgctcaagcaacagcctgag
ccgagtccgcaacctactcttttcgtccgctcggaggagcctgcgccataccagaccgtt
gaggaaagcaggatcacccgcaaaaagatgaccccgatccgcagaaagattgccgaaaga
ctgctggcggcgcggcagcagacggccatgctcaccaccttcaatgaggtcgatatgggc
aggatcatggagctgcgccggcagcacaaggaacacttccagaagaaattcggggtgacc
ctggggtttatgcccttcttcatcaaggcctgtatcgatgccctccgtgaattccccatg
gtcaacgcccgcatcgacggcgatgaaatagtccagcagcatttctatgacatgggtata
gccattggcggcgaaaagggactggtggtgccggttatccgcgatgccgaccggttgacc
cttgtggagatggagaaaaagatacgatcgctggtggagcaggtcgagaacaaccgcttg
agccttgaagatttgaccggcggcaccttcaccatcagtaacggcggcgtttatggttcc
atgctcagcacccccatactcaatccgccccagagcggtgtgctggggatgcatgccatt
caggaccggccggtggccagggacgggcaggtggtgatccgtcccatgatgtacctggcg
ctctcctacgaccatcgcattatcgatgggcgggaggcggtggggttcctcaagagggtg
aaagagtatgtcgaggatccggaggaaatgctgttggagggatag

DBGET integrated database retrieval system