KEGG   Geobacter sp. FRC-32: Geob_1949Help
Entry
Geob_1949         CDS       T00846                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
geo  Geobacter sp. FRC-32
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geob_1949
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geob_1949
  Amino acid metabolism
   00310 Lysine degradation
    Geob_1949
Enzymes [BR:geo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Geob_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2183240..2184424
Genome map
AA seq 394 aa AA seqDB search
MEIKVPAVGESITEALVAKWHKGDGERVEKDEVLCEIETDKITLEINADASGTLAIRAKE
GETVQIGAVIGTIDEKGAAGQASGPAKPSGPEKEKTEPQPPLSPAVRKMAQEKGIKAETI
KGSGKGGRVTVDDLLKQQPEPSPQPTLFVRSEEPAPYQTVEESRITRKKMTPIRRKIAER
LLAARQQTAMLTTFNEVDMGRIMELRRQHKEHFQKKFGVTLGFMPFFIKACIDALREFPM
VNARIDGDEIVQQHFYDMGIAIGGEKGLVVPVIRDADRLTLVEMEKKIRSLVEQVENNRL
SLEDLTGGTFTISNGGVYGSMLSTPILNPPQSGVLGMHAIQDRPVARDGQVVIRPMMYLA
LSYDHRIIDGREAVGFLKRVKEYVEDPEEMLLEG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaagttccggcagtgggggaatcgatcaccgaggcgctggttgccaagtgg
cacaagggggatggcgagcgggtggagaaggatgaggtcctctgcgagatcgagaccgac
aagatcaccctggagatcaatgcagatgcttccggaacccttgccatccgggcaaaggaa
ggggaaacggtgcagattggcgctgtcatcggcaccattgatgaaaaaggtgcggcaggg
caggcctctggcccggcgaagccatcaggcccggaaaaggaaaaaacagagccgcagccg
ccgctttctccggcggtgcggaagatggcccaggaaaagggaataaaggctgaaaccatc
aaggggagcggcaaggggggcagagtaacggtggacgacctgctcaagcaacagcctgag
ccgagtccgcaacctactcttttcgtccgctcggaggagcctgcgccataccagaccgtt
gaggaaagcaggatcacccgcaaaaagatgaccccgatccgcagaaagattgccgaaaga
ctgctggcggcgcggcagcagacggccatgctcaccaccttcaatgaggtcgatatgggc
aggatcatggagctgcgccggcagcacaaggaacacttccagaagaaattcggggtgacc
ctggggtttatgcccttcttcatcaaggcctgtatcgatgccctccgtgaattccccatg
gtcaacgcccgcatcgacggcgatgaaatagtccagcagcatttctatgacatgggtata
gccattggcggcgaaaagggactggtggtgccggttatccgcgatgccgaccggttgacc
cttgtggagatggagaaaaagatacgatcgctggtggagcaggtcgagaacaaccgcttg
agccttgaagatttgaccggcggcaccttcaccatcagtaacggcggcgtttatggttcc
atgctcagcacccccatactcaatccgccccagagcggtgtgctggggatgcatgccatt
caggaccggccggtggccagggacgggcaggtggtgatccgtcccatgatgtacctggcg
ctctcctacgaccatcgcattatcgatgggcgggaggcggtggggttcctcaagagggtg
aaagagtatgtcgaggatccggaggaaatgctgttggagggatag

DBGET integrated database retrieval system