KEGG   Geobacter daltonii FRC-32: Geob_2180Help
Entry
Geob_2180         CDS       T00846                                 

Definition
(GenBank) aminopeptidase, M42 family
Organism
geo  Geobacter daltonii FRC-32
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2417678..2418748
Genome map
AA seq 356 aa AA seqDB search
MRDQSFEFLQNLLAAPSPSGYEQPAQRVFRSYVAPFAAISTDVMGNVFGAIEGGGENRPR
VMLVGHSDEIGFQIKYMDDNGFIYFGAIGGVDPHLSTGQKVNIHGSKGIIPGVIGKKPIH
LMEPKDRETVVKLDAQYIDIGVASKKEAEALVRVGDPVTFAVSLSTLQGDRVTSRGFDDK
AGSFVVAEVLRQVSELSAKLQVDLYGVSSVQEEVGLRGGTTSSYTVNPDIGICVEVDFAT
DQPDVDKKHNGEVKIGKGPILPRGANINPALFDLLAETAAAENIPVQFTGIPRATGTDAN
VMQISRGGVATALVKIPLRYMHTPVEVLSLSDLENAVRLIVATLTRIKDKQVFIPN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatcaatcctttgaatttttacagaaccttttggcggctcccagtccttccggt
tacgaacagcctgcccagcgggttttccgctcttatgtcgctccattcgcagcgatcagt
accgatgtcatgggcaatgtcttcggtgccatcgagggcggcggtgaaaatcgcccacgg
gtgatgctggtcggtcattccgatgaaataggtttccagatcaagtatatggatgacaac
ggcttcatctatttcggcgccattggcggcgtcgatccgcatctttccaccggtcagaag
gtaaatatccatggcagcaagggcatcatccccggcgtgatcggcaagaagcccattcat
ttgatggagcccaaggacagggaaacagtggtgaagctggacgcccagtacatagatatc
ggcgtagcaagcaagaaagaggcggaagcactcgttcgtgtcggtgatccggtgaccttc
gccgtcagtctgagcacgctgcagggtgatcgtgtcaccagtcgcgggttcgacgacaag
gcgggaagctttgtcgttgccgaagtgctgcggcaggtttcggagttgagcgccaaactt
caggtcgatctgtatggagtttcctcggttcaggaggaggtcgggttgagggggggcacc
accagcagttatacagtcaaccctgatatcggcatctgcgtcgaggtggatttcgccaca
gaccagcctgacgtggataagaagcataacggcgaggtgaagatcggcaaggggccgatc
ctgccccgtggcgccaatatcaatccggctctcttcgatcttttggctgaaacggcggct
gcggaaaacattcctgtccaattcaccggcattccgcgggccaccggcaccgacgccaat
gtgatgcaaatttccaggggaggtgtcgccactgccctggtgaaaattccgctgcgctac
atgcacacacccgtcgaggtgctctcgctctcagacctggaaaatgcggtcaggctcata
gtcgcgactctgaccaggatcaaggacaagcaggtattcataccaaactga

DBGET integrated database retrieval system