KEGG   Geobacter sp. FRC-32: Geob_2251Help
Entry
Geob_2251         CDS       T00846                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
geo  Geobacter sp. FRC-32
Brite
Enzymes [BR:geo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Geob_2251
Secretion system [BR:geo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Geob_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2489638..2490423
Genome map
AA seq 261 aa AA seqDB search
MKSLTTAVVLVTLMAGSASAMSKEGCGGECASCHPLSVKEANALVKDLGGRVTKVKFPAM
RGVWELDMEKDGKKAVAYLDYGKKHVIPGPIFNLATKKPISGGAQQPAGVTKVNPALLTP
ANSIILGNPQGKKRLFVFTDPDCPFCAKLHVELKKLIAMDPSVVVYVKLFPLKMHPAAYD
KSRVILQGPSAKLLDDAFAKVTLPAPGPNTPTKGVEENIKLAGRLGVNSTPTMIFSDGRV
VAGSKSATEIQALFKIKKPHK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtttgactactgcagtagtgttggtgactctaatggctggaagcgcctcggcc
atgtccaaggaggggtgtggcggggaatgtgcctcgtgtcatcctctttctgtgaaagag
gccaatgcacttgtaaaagaccttggggggcgggtaacaaaggtgaaatttccggccatg
cgtggcgtctgggagcttgacatggagaaggatggtaaaaaggccgtcgcctacctggat
tacggcaagaaacacgtcattcccggccccatattcaatctggcgactaaaaaacccata
agtggcggggcacaacagccggccggagtaaccaaggtgaatccggctcttcttacgcct
gccaactccataattctcggaaatcctcaggggaaaaaaaggctttttgtctttaccgat
ccagattgccccttttgcgcaaaactgcatgtggagctgaagaagcttatcgccatggat
ccgtcggtagtcgtgtacgtgaaactgttcccgttgaaaatgcatcccgcagcctacgac
aaatcccgggtcatactccagggaccgtcggccaagcttctcgacgatgcctttgccaag
gtgaccttgcctgctcctggccctaatacgccgaccaaaggtgtggaggaaaatatcaag
cttgccgggcggctcggcgtcaattctacgccgacgatgattttttccgatggcagggtg
gtggccggctcaaagtctgccactgaaattcaggctctttttaagattaaaaagccgcat
aaatga

DBGET integrated database retrieval system