KEGG   Geobacter sp. FRC-32: Geob_2516Help
Entry
Geob_2516         CDS       T00846                                 

Definition
alcohol dehydrogenase zinc-binding domain protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
geo  Geobacter sp. FRC-32
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Geob_2516
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_2516
  Lipid metabolism
   00071 Fatty acid degradation
    Geob_2516
  Amino acid metabolism
   00350 Tyrosine metabolism
    Geob_2516
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Geob_2516
   00626 Naphthalene degradation
    Geob_2516
Enzymes [BR:geo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Geob_2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2766325..2767350)
Genome map
AA seq 341 aa AA seqDB search
MLPETMKAAVVHEFGKRLSIQNVSVPRPGLGQVLVRVMASGVCHTDLHAADGDWPVKPKL
PFIPGHEGAGYVAAVGPGVTVLKEGDRVGVAWLHSACGHCDYCLTGWETLCQQQDNTGYS
VDGAYAEYVLAPAAYVARIPDGLDFTEAAPILCAGVTTYKGLKQTDTKAGDWVAIVGIGG
LGHMAVQYAKAMGLHVAAVDISEEKLELARSLGAELIVNAEKTDAATMIQKQVGGAHGVL
VTAVSPRIFRQSLDMLRRGGTCTLVGLPPGEFPMPIFDIVLKGITVRGSIVGTRKDLQEC
LQFAAEGKVKAVIETQALEAVNEVFDRLKRGQVSGRVVLKL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttacctgaaaccatgaaggctgccgttgtccatgaattcgggaagcgcttgagcatt
caaaacgtatcggttccccggcccggactgggacaggtcctggtgagggttatggccagt
ggggtatgtcacaccgacctccatgccgccgatggggattggcccgtgaagcccaaattg
ccgtttattccgggtcatgaaggcgccgggtatgttgccgccgtaggaccgggggtaacg
gttctgaaagagggagaccgcgttggcgttgcctggttgcacagcgcctgcggacattgt
gattactgcctgacgggctgggaaacactctgtcagcagcaagacaacaccggttactcg
gtcgatggcgcctatgcggaatacgtgttggcacccgcagcctatgtggcacgcataccc
gacggtctggatttcacagaagctgccccgatcctgtgtgccggcgtgaccacatacaag
gggctcaagcagaccgacaccaaggccggtgattgggtggccatagtcggtatcggcgga
ttgggacacatggcggtccagtatgcaaaagcaatgggactgcatgtggcggctgtcgat
atttccgaggagaagctggagctggcaaggagcctcggcgctgaactgatagtcaatgcg
gaaaagacggatgctgccacaatgattcagaagcaggtcggcggggcacatggtgtcctg
gtcaccgcagtttcacccaggatcttccggcagtcactggacatgctgcggcgtggcggt
acatgcacgctggtcggtctccctccgggggagtttcccatgccgatcttcgacatcgtg
ctgaaagggattaccgttcgcggctcgatcgtggggacacgtaaagatctgcaggaatgc
ttgcagtttgccgccgaaggcaaagtcaaagccgtcatcgagacacaggcactggaagct
gtcaatgaggtgtttgaccggctgaagcgcggccaggtgagtgggcgcgttgtcctgaag
ctttga

DBGET integrated database retrieval system