KEGG   Geobacter daltonii FRC-32: Geob_2683Help
Entry
Geob_2683         CDS       T00846                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00260  Glycine, serine and threonine metabolism
geo00750  Vitamin B6 metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Geob_2683 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Geob_2683 (thrC)
Enzymes [BR:geo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Geob_2683 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACM21033
JGI: Geob_2683
UniProt: B9M1F1
Position
complement(2949643..2951025)
Genome map
AA seq 460 aa AA seqDB search
MKYISTRGNIAPVGFKDAVMMGLATDGGLLLPERFPVIDDGTLSAWRSLPYRELAFQVIS
RFVDDIPAADLKNLIDKSYDSFAHEEITPVVAKNGVHILELFHGPTLAFKDVALQLLGNL
FEYLLKESGRKMNIVGATSGDTGSAAIYGVRGKENINIFILHPYGKTSPIQARQMTTVLD
ANVFNIAVNGTFDDCQNIVKDLFNDLPFKEQYALGAVNSINWARVLAQVVYYFYAWFRVT
DSQESPVVFSVPTGNFGDIFAGYVAKRMGLPIAKLLLATNENNILTRFINDGDYSKGSVV
QTVSPSMDIQVASNFERYLYYLFDESPARVRECFSQFAATGRMTFTAEELERVRKDFASR
SVNEEETLETIAAFHLETSYILDPHTAVGVKAAQDCAAGSTVVCLATAHPAKFAEAVEKA
TGNRPPLPGSLEGIEQLPTRCEVMPADRATIQNYVAEKAL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcaccaggggaaatatcgccccggttggcttcaaagacgctgtaatg
atgggccttgccacagatggcggcctccttctacctgaacgttttccggtcatagacgac
ggaaccctttctgcatggcgttctctcccctaccgtgaactggcatttcaggtaatctcc
cgctttgtggacgatattcccgccgccgacctgaaaaacctcatcgataaatcatatgac
agcttcgcccacgaagaaatcaccccggtcgtagccaaaaacggcgtccatatcctggag
cttttccatggacctaccctggccttcaaggatgttgcccttcagcttctcggcaacctt
ttcgaatatctgctgaaagagagcggcagaaaaatgaacatcgtcggtgccacctccggc
gatacgggaagcgctgccatctatggcgtcaggggcaaggaaaacatcaatatcttcatc
ctccacccatacggcaagacttctcccattcaggcgcggcaaatgaccaccgttcttgac
gcaaatgtcttcaacatcgcggtcaatggcaccttcgatgactgccagaatattgtcaag
gacctgttcaacgaccttcccttcaaggaacagtatgccttgggcgccgttaactccatt
aactgggcacgggtcctggcccaggtcgtctactatttctacgcatggttccgggtaacc
gattcccaggaaagcccggtggttttttccgttcccaccggcaatttcggcgatatcttt
gccggatatgtggcaaaacgtatgggactccccatagcaaaactgctgctggcaaccaat
gagaacaacattcttacccgtttcatcaatgatggcgactactccaaaggatcggtagtc
cagacggtctctccatccatggacattcaggtggcatccaacttcgagcgctacctttac
tacctgttcgatgaaagccctgcccgggtccgcgaatgtttcagtcaatttgccgcaaca
ggcaggatgacctttactgccgaagaattggagagggtgcgcaaagactttgcttcccgc
tctgtcaacgaagaggaaacccttgaaaccattgccgcatttcacttggaaacttcctat
atcctggatccccataccgcggtcggggtcaaggccgctcaggattgcgccgcaggcagc
acagtagtatgcctggctacggcccacccggccaaatttgccgaagcagtagaaaaggcc
accggcaatcgccctcccctgccaggctccctggaagggatagaacagctgccgacccgt
tgcgaagttatgcctgcggaccgggcaacaatacagaactacgtggctgagaaggctctt
taa

DBGET integrated database retrieval system