KEGG   Geobacter daltonii FRC-32: Geob_2879Help
Entry
Geob_2879         CDS       T00846                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geob_2879
   01230 Biosynthesis of amino acids
    Geob_2879
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_2879
   00030 Pentose phosphate pathway
    Geob_2879
   00051 Fructose and mannose metabolism
    Geob_2879
   00052 Galactose metabolism
    Geob_2879
  Energy metabolism
   00680 Methane metabolism
    Geob_2879
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Geob_2879
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Geob_2879
Protein phosphatases and associated proteins [BR:geo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Geob_2879
Messenger RNA biogenesis [BR:geo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Geob_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3140401..3141486)
Genome map
AA seq 361 aa AA seqDB search
MKKRIGVLTGGGDCPGLNAVIRGVVKAAIIQHGWEVVGIEDGFDGLLTGRCRQLSIDDVR
GILPRGGTILGTSNRGNPFARPVEKGGKIEYVDSSNEVVERIKSLGIGALVVIGGEGSFK
IAMDLMNKGVPIVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIME
VMGRYAGWIALESGIAGGADVILIPEIPFDIRKICLAIEKRRNNGSRFSIIVAAEGAFPA
GGMRVVKNSADATHAIERLGGVGEFVANELAANLDMDVRVMVLGHLQRGGSPSTFDRCLG
SRFGVKAVELVDRNEFGTMVCLKGRDIGNVAIEKAIKQLKVVDPDGEMVKSAVNLGIMLG
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggattggcgtacttaccggcggtggagactgtccagggcttaatgcagtc
atcagaggcgtcgttaaagcagccatcattcaacacggctgggaagtagtcggtattgag
gacggtttcgacggattgctgaccggcagatgtcgtcagttatccatcgatgatgtgcgc
ggtatcctcccccgtggagggaccattctcggaacttccaacaggggtaaccccttcgcc
cgtccggttgaaaaggggggcaagatcgaatatgttgattcttccaatgaagttgttgaa
cgaataaaatctcttggcataggggctctggtcgttatcggcggtgaaggctcctttaag
atcgcaatggatttgatgaacaagggtgtgcccattgtcggtgtaccgaaaaccatcgat
aacgacctgatggaaacggatgtgaccttcggttacaatactgcccttgaaacggcaacc
gatgcactggacaaactgcattccactgcagagagccatcaccgggtgatgataatggag
gtcatgggaagatatgccggctggatagctttggaatcaggtatagccggaggtgcagat
gtcatcctcatacctgaaatccctttcgacatccggaaaatctgcctggccatagaaaaa
aggcgtaacaacggcagccgtttcagtattattgtggcagctgaaggggcctttcctgcg
gggggcatgagagttgtaaaaaacagcgccgatgctactcatgccattgagcgtttgggc
ggcgtcggagaattcgtggcgaacgagctagccgcgaacctggacatggatgtacgggtt
atggtgctcggtcacctgcagcgcggcggatcaccatccacctttgacaggtgtctggga
agccgtttcggagtcaaggctgtggaacttgttgaccggaatgagttcggcacgatggta
tgtctcaaaggaagggatattggcaatgtagccattgaaaaggcgatcaaacagcttaaa
gttgtggatcccgatggtgaaatggtgaaatctgccgtaaatttggggataatgcttggc
aggtga

DBGET integrated database retrieval system