KEGG   Geobacter daltonii FRC-32: Geob_2879Help
Entry
Geob_2879         CDS       T00846                                 

Gene name
pfk-1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00010  Glycolysis / Gluconeogenesis
geo00030  Pentose phosphate pathway
geo00051  Fructose and mannose metabolism
geo00052  Galactose metabolism
geo00680  Methane metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_2879 (pfk-1)
   00030 Pentose phosphate pathway
    Geob_2879 (pfk-1)
   00051 Fructose and mannose metabolism
    Geob_2879 (pfk-1)
   00052 Galactose metabolism
    Geob_2879 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    Geob_2879 (pfk-1)
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Geob_2879 (pfk-1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Geob_2879 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACM21223
JGI: Geob_2879
UniProt: B9M2A5
Position
complement(3140401..3141486)
Genome map
AA seq 361 aa AA seqDB search
MKKRIGVLTGGGDCPGLNAVIRGVVKAAIIQHGWEVVGIEDGFDGLLTGRCRQLSIDDVR
GILPRGGTILGTSNRGNPFARPVEKGGKIEYVDSSNEVVERIKSLGIGALVVIGGEGSFK
IAMDLMNKGVPIVGVPKTIDNDLMETDVTFGYNTALETATDALDKLHSTAESHHRVMIME
VMGRYAGWIALESGIAGGADVILIPEIPFDIRKICLAIEKRRNNGSRFSIIVAAEGAFPA
GGMRVVKNSADATHAIERLGGVGEFVANELAANLDMDVRVMVLGHLQRGGSPSTFDRCLG
SRFGVKAVELVDRNEFGTMVCLKGRDIGNVAIEKAIKQLKVVDPDGEMVKSAVNLGIMLG
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggattggcgtacttaccggcggtggagactgtccagggcttaatgcagtc
atcagaggcgtcgttaaagcagccatcattcaacacggctgggaagtagtcggtattgag
gacggtttcgacggattgctgaccggcagatgtcgtcagttatccatcgatgatgtgcgc
ggtatcctcccccgtggagggaccattctcggaacttccaacaggggtaaccccttcgcc
cgtccggttgaaaaggggggcaagatcgaatatgttgattcttccaatgaagttgttgaa
cgaataaaatctcttggcataggggctctggtcgttatcggcggtgaaggctcctttaag
atcgcaatggatttgatgaacaagggtgtgcccattgtcggtgtaccgaaaaccatcgat
aacgacctgatggaaacggatgtgaccttcggttacaatactgcccttgaaacggcaacc
gatgcactggacaaactgcattccactgcagagagccatcaccgggtgatgataatggag
gtcatgggaagatatgccggctggatagctttggaatcaggtatagccggaggtgcagat
gtcatcctcatacctgaaatccctttcgacatccggaaaatctgcctggccatagaaaaa
aggcgtaacaacggcagccgtttcagtattattgtggcagctgaaggggcctttcctgcg
gggggcatgagagttgtaaaaaacagcgccgatgctactcatgccattgagcgtttgggc
ggcgtcggagaattcgtggcgaacgagctagccgcgaacctggacatggatgtacgggtt
atggtgctcggtcacctgcagcgcggcggatcaccatccacctttgacaggtgtctggga
agccgtttcggagtcaaggctgtggaacttgttgaccggaatgagttcggcacgatggta
tgtctcaaaggaagggatattggcaatgtagccattgaaaaggcgatcaaacagcttaaa
gttgtggatcccgatggtgaaatggtgaaatctgccgtaaatttggggataatgcttggc
aggtga

DBGET integrated database retrieval system