KEGG   Geobacter daltonii FRC-32: Geob_2899Help
Entry
Geob_2899         CDS       T00846                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00010  Glycolysis / Gluconeogenesis
geo00051  Fructose and mannose metabolism
geo00562  Inositol phosphate metabolism
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01120  Microbial metabolism in diverse environments
geo01130  Biosynthesis of antibiotics
geo01200  Carbon metabolism
geo01230  Biosynthesis of amino acids
Module
geo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_2899 (tpi)
   00051 Fructose and mannose metabolism
    Geob_2899 (tpi)
   00562 Inositol phosphate metabolism
    Geob_2899 (tpi)
Enzymes [BR:geo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Geob_2899 (tpi)
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Geob_2899 (tpi)
  Exosomal proteins of bladder cancer cells
   Geob_2899 (tpi)
  Exosomal proteins of melanoma cells
   Geob_2899 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACM21242
JGI: Geob_2899
UniProt: B9M2C4
Position
3167106..3167861
Genome map
AA seq 251 aa AA seqDB search
MRTPVIAGNWKLYKTAGQALELVGGLLPLVAQTKGVEIVVAPVFTVLGKVAEALAGSNIH
LSAQDCFWEEEGAFTGEISSTMLIDAGCSHVIIGHSERRQFFGETDATVNKKIKAAIKAG
LTVLFCIGETLQEREGDQTFDVLRRQVTQGLRDLSQEQLKKVIIAYEPVWAIGTGKTATD
SQAQEAHQFIRGVIAGLYDKDAAEEMRILYGGSVKPENIGGLMAQADIDGALVGGASLKA
DSFAAIAKLGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgcctgtgattgctggaaattggaagctttacaaaactgcgggccaggcactc
gaactggttggcggcctgctcccgcttgtcgcccagactaaaggggttgaaattgttgtc
gctcctgtatttaccgtacttggtaaagttgccgaggctctcgccgggtcgaacattcac
ctttctgcccaggattgtttttgggaggaagaaggtgcctttaccggcgaaatttcgagc
accatgttgattgatgcgggctgcagccatgtcattatcggccattcggagcgcagacaa
ttcttcggtgaaacggatgctacggtaaataaaaaaatcaaagctgccatcaaggcaggt
ttgaccgttttattctgtattggtgagactctccaggaacgtgagggggatcagaccttc
gatgtcctgaggcgtcaggttacccaggggctgagggacctatcccaggaacagctgaaa
aaggtaattattgcctacgaaccagtctgggccatcggcacagggaaaactgccactgac
agccaggctcaggaagctcaccaattcattcgtggtgttatcgcaggtttatatgacaag
gatgcagcagaagaaatgcgaattctttacggtggaagtgtaaaaccggaaaacatcggt
ggcttgatggcccaagccgatatcgatggagccctggttggcggagcaagtctcaaggcc
gattcattcgcagccattgccaagttgggtaaataa

DBGET integrated database retrieval system