KEGG   Geobacter daltonii FRC-32: Geob_2899Help
Entry
Geob_2899         CDS       T00846                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geob_2899 (tpiA)
   01230 Biosynthesis of amino acids
    Geob_2899 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_2899 (tpiA)
   00051 Fructose and mannose metabolism
    Geob_2899 (tpiA)
   00562 Inositol phosphate metabolism
    Geob_2899 (tpiA)
Enzymes [BR:geo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Geob_2899 (tpiA)
Exosome [BR:geo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Geob_2899 (tpiA)
  Exosomal proteins of bladder cancer cells
   Geob_2899 (tpiA)
  Exosomal proteins of melanoma cells
   Geob_2899 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3167106..3167861
Genome map
AA seq 251 aa AA seqDB search
MRTPVIAGNWKLYKTAGQALELVGGLLPLVAQTKGVEIVVAPVFTVLGKVAEALAGSNIH
LSAQDCFWEEEGAFTGEISSTMLIDAGCSHVIIGHSERRQFFGETDATVNKKIKAAIKAG
LTVLFCIGETLQEREGDQTFDVLRRQVTQGLRDLSQEQLKKVIIAYEPVWAIGTGKTATD
SQAQEAHQFIRGVIAGLYDKDAAEEMRILYGGSVKPENIGGLMAQADIDGALVGGASLKA
DSFAAIAKLGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgcctgtgattgctggaaattggaagctttacaaaactgcgggccaggcactc
gaactggttggcggcctgctcccgcttgtcgcccagactaaaggggttgaaattgttgtc
gctcctgtatttaccgtacttggtaaagttgccgaggctctcgccgggtcgaacattcac
ctttctgcccaggattgtttttgggaggaagaaggtgcctttaccggcgaaatttcgagc
accatgttgattgatgcgggctgcagccatgtcattatcggccattcggagcgcagacaa
ttcttcggtgaaacggatgctacggtaaataaaaaaatcaaagctgccatcaaggcaggt
ttgaccgttttattctgtattggtgagactctccaggaacgtgagggggatcagaccttc
gatgtcctgaggcgtcaggttacccaggggctgagggacctatcccaggaacagctgaaa
aaggtaattattgcctacgaaccagtctgggccatcggcacagggaaaactgccactgac
agccaggctcaggaagctcaccaattcattcgtggtgttatcgcaggtttatatgacaag
gatgcagcagaagaaatgcgaattctttacggtggaagtgtaaaaccggaaaacatcggt
ggcttgatggcccaagccgatatcgatggagccctggttggcggagcaagtctcaaggcc
gattcattcgcagccattgccaagttgggtaaataa

DBGET integrated database retrieval system