KEGG   Geobacter sp. FRC-32: Geob_2948Help
Entry
Geob_2948         CDS       T00846                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
geo  Geobacter sp. FRC-32
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Geob_2948
Enzymes [BR:geo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Geob_2948
Peptidases [BR:geo01002]
 Cysteine Peptidases
  Family C44
   Geob_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3212906..3214876
Genome map
AA seq 656 aa AA seqDB search
MCGIAGICNPGRSPEVLVSRMIAVMRHRGPDASGIFLDANMAMGHARLSIIDLGGGTQPI
CNEDGRLWIVYNGEIFNYPELRALLLKKGHVFRTATDTEVLVHLYEEYGPDALSMVNGQF
AFAIWDTRKKELFLARDRVGIRPLFYTRNDNQLVFASEIKAIFQDPAIKRELDLQALKQI
FTFWTTVGDRTAFKNVHELRPGHYMVFRDGRIVEEKAFWSLPFYQKEERWQGTFGEACEE
LRELLLDAVRLRLRADVPVGAYLSGGLDSSIITSLISSRFDNNLRTFSVGFDESPFDETP
FQDEMVRFLGTGHTNRRIKNTDIRDNLPKVIWHCEKPLLRTAPVPLFILSKVVSDNSFKI
VLTGEGADEIFGGYNIFKEAKIRRFWANQPESRVRPLLLEKLYPYIFQNPARERTFLQKF
YGVDAADSEDPFFSHGIRWKNTGRNVMFFSEDVTTALKGYQPVQELKAALPLDFDGRDCL
AKAQYLETSIFLSNYLLSSQGDRVAMANSVEMRVPFLDFRVIDFAMRLPPKWKIRALNEK
YILKKTFAGNLPPRITNRPKHPYRAPIQDVFFQNLPGYVDHLVSDQYLKKTGIFDPGKTG
FLVAKFRKKQKLGESETENMALTGIISTQLLYQQFMENFQIADITNFEVNKIIRLN
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagcgggcatatgcaatccgggacgctcacctgaagttctggtctcaagg
atgatcgccgtcatgcggcaccggggccccgatgcgtcgggcattttcctggatgccaac
atggccatggggcatgcccgcctcagcatcatcgacctggggggaggcactcaaccgatc
tgtaatgaggatgggcggctctggatcgtatataacggcgagattttcaattatcccgaa
ctgcgggcgctgcttttgaaaaaggggcatgtgtttcggacggcgaccgatacggaagtg
ctggtgcatctttatgaagaatatggccccgatgccctgtccatggtcaatgggcagttc
gccttcgccatatgggatacccggaagaaagaactctttctggcaagggaccgggttggc
atcaggccgctcttctacacccggaatgacaaccagcttgtctttgcctcggaaatcaaa
gccatttttcaggacccggccataaaaagggaactcgatcttcaggcactgaagcagatc
ttcaccttttggacgacagtcggcgatagaactgcctttaaaaatgtccacgaattgcgt
cccggtcattacatggtcttcagagacggcaggatagtggaagaaaaggccttctggagt
ctccccttttatcaaaaggaagaaaggtggcagggaacattcggagaagcctgcgaagaa
ctacgggagttgctcttggatgcagtcaggttgagactgcgtgccgatgttccggtcgga
gcctacctgagcggtggattggactcttccataatcacttccctcatctcaagcaggttc
gacaataatttaaggactttttccgtcggattcgacgaaagtcccttcgacgaaactcct
tttcaggatgagatggtcagatttctggggacgggccatacgaaccggcgaataaagaat
accgacattcgggataacctgccgaaggtgatctggcattgcgaaaagcccctgctgaga
actgctcctgtgcccttgttcatactctcgaaggtggtcagtgacaacagcttcaagatc
gtattgaccggtgaaggtgccgacgaaatcttcggcggctacaacatcttcaaagaggca
aagattcgccgattctgggcaaaccagccggagtcaagggtgcgccctcttcttctggaa
aagctttacccatacattttccagaacccggccagggaaaggacttttctgcagaaattc
tacggggttgacgccgccgattcggaagaccctttcttctcccatggcatccgctggaag
aataccggcagaaacgtcatgtttttttcagaggatgtgaccactgccctcaaaggatat
cagcccgttcaggaactgaaggcggcactcccccttgattttgacggccgggattgcctg
gcgaaggcccagtacctggagacgagcatcttcctttccaactacctgctttcctcccag
ggagaccgggtagccatggcaaattcggtggaaatgagggtaccctttctggacttcagg
gtcatcgatttcgccatgaggctccctcccaaatggaagatcagggccttgaacgaaaag
tatatcctgaaaaaaacctttgccggaaacctgccccccaggattaccaatcgtcccaag
cacccgtaccgggcgccgatacaggatgtcttcttccagaacctgcccggttatgtcgat
cacctggtgtccgatcagtatctgaagaagaccggcatcttcgatcccggcaagaccggc
tttctggttgccaaattcagaaaaaaacagaagctgggcgaaagcgagacggagaacatg
gccctgacgggaattatctcgacgcaactcctttaccagcagttcatggaaaatttccaa
attgcagacataactaattttgaggtgaataagatcattcgactcaattaa

DBGET integrated database retrieval system