KEGG   Geobacter daltonii FRC-32: Geob_3321Help
Entry
Geob_3321         CDS       T00846                                 

Definition
(GenBank) protein disulfide bond isomerase, DsbC/DsbG-like
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
geo  Geobacter daltonii FRC-32
Brite
Enzymes [BR:geo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Geob_3321
Chaperones and folding catalysts [BR:geo03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Geob_3321
Secretion system [BR:geo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Geob_3321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N Thioredoxin_4 DSBA Glutaredoxin Thioredoxin_3 Thioredoxin Thioredoxin_5 Thioredoxin_7 Ail_Lom
Motif
Other DBs
NCBI-ProteinID: ACM21664
JGI: Geob_3321
UniProt: B9M4Y0
Position
complement(3658817..3659527)
Genome map
AA seq 236 aa AA seqDB search
MTIISRKLCAGFLLALVCSPAAFAATAAVKPEVAFKQAYPQVKVDSFESTDINGLYQVVT
GQNVLYYLPEKDYVILGEIFTKEGKSLTAEKKGQMAAKLVQSLPLDKAVKIGEGKNVIVE
FTDPDCPYCRKASEYLMKKTNVTRYVFFTPLAHPAAIAKIQYILNAENKVKAYDEMMLGQ
EIPANAPAVSDKVKALAQEHIELAKKMGVQGTPTFFVNGQQVVGADTNKIDQLLKK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcatcagcagaaagctttgcgcaggatttttactggctttggtctgctcgccg
gccgcttttgccgctaccgcagccgtaaagcccgaggtcgccttcaaacaggcctatcct
caggtaaaggtggacagctttgaatcaacggacatcaatggtctgtatcaggtggttacc
ggccagaatgtgctctattacctgccggagaaggattacgtaatactcggggagatattc
accaaggaaggcaaaagcctgacggcggagaaaaaagggcaaatggcagccaagctggtg
cagagcctgccgttggacaaggcagtgaaaatcggcgagggaaagaatgttatcgtcgag
tttaccgatcctgactgtccatactgtcggaaagcttcagagtacctcatgaagaagacg
aatgtcacccgctacgtgttctttactccactggcccatcctgcagccatcgccaagatc
cagtacatcctcaatgccgaaaacaaggtgaaagcctatgacgagatgatgctgggccag
gagattcctgccaatgccccggcggtgagcgacaaggtcaaggcgctggcccaggaacac
atcgaactggccaaaaaaatgggggtccaggggacgccgaccttctttgtcaatggccag
caggtggttggcgccgatacaaacaagatcgatcaattactgaagaaataa

DBGET integrated database retrieval system