KEGG   Geobacter sp. FRC-32: Geob_3380Help
Entry
Geob_3380         CDS       T00846                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
geo  Geobacter sp. FRC-32
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:geo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Geob_3380
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Geob_3380
Enzymes [BR:geo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Geob_3380
Two-component system [BR:geo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Geob_3380
Bacterial motility proteins [BR:geo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Geob_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3736056..3737108)
Genome map
AA seq 350 aa AA seqDB search
MTANGQRKIRVLVVDDSAFVRRAIVRMFENSSDIQVIDVASNGEMAIDMIKSLKPDVVTL
DVKMPVLDGLSALERIMKECPAPVIMLSSLMEKGGDNTLRALELGAVDFVDKSAAGGAMD
ISVLARELISKIRMAAQVDVDKLRVGEGREVSPPVQVVAEKRETEVVLIGTSTGGPPALQ
NILTRIPASFPCPILIVQHMPAGFTAPLAERLDRLCAVPVKEAKNDEAVMPGTVYIAPAG
SHLKLKREGNHLLVVLDSLPEGTLHRPSVDVLFESAAAACGGKILSFVLTGMGRDGASGA
KAVKDAGGKVFIESEKTCIVFGMPKAVMDTVNIDGEILLDKVAETMIRSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaatgggcaacggaaaatacgggtgttggtggtcgatgattcggccttcgtg
agaagggccatagtccggatgttcgagaacagttcggacatccaggtcattgatgtggcc
tccaatggagaaatggccatagatatgatcaaatccctgaaaccggacgtggtgaccctg
gatgtgaagatgccggttttggatggtctgtccgccctggaaaggatcatgaaggaatgc
ccggcgccggtgatcatgctcagctccctgatggagaaagggggcgacaacacactgcgc
gccctggaactgggggcagtggattttgtcgacaaatctgccgcaggcggtgctatggat
atttccgtgcttgcccgggaactgatctccaaaatcaggatggcggcccaggtggatgtg
gacaaactccgggtgggggagggaagagaggtctcgccgccggtccaggtggtggcggaa
aagagggaaacggaggtcgtgctgatcggtacatcgacaggtgggccaccggcattgcag
aacattctgaccaggattcccgcttctttcccctgtcccatactgatcgtccagcacatg
cctgccggtttcactgcgccattagcggaacggctcgatcgcctttgtgctgtacctgtc
aaggaagcgaaaaacgatgaggcggtaatgcccggtacggtctatatcgctccggccgga
agtcacctgaagttgaaaagggaggggaatcacctgctcgttgtcctggattcccttccg
gaggggacgttgcaccggccctcggtagatgtgctctttgaatcagcagcagctgcctgt
ggcggtaaaatcctttcctttgtcctgaccggaatgggcagggatggagcctcgggcgcc
aaagccgtcaaggatgcaggaggcaaagtttttatcgagtcggagaaaacctgtatcgtt
ttcggcatgcccaaagcggttatggatactgtaaatatagatggtgaaattcttctcgac
aaggtggcagagaccatgatccggtccttttga

DBGET integrated database retrieval system