KEGG   Geobacter sp. FRC-32: Geob_3380Help
Entry
Geob_3380         CDS       T00846                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
geo  Geobacter sp. FRC-32
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:geo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:geo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3736056..3737108)
Genome map
AA seq 350 aa AA seqDB search
MTANGQRKIRVLVVDDSAFVRRAIVRMFENSSDIQVIDVASNGEMAIDMIKSLKPDVVTL
DVKMPVLDGLSALERIMKECPAPVIMLSSLMEKGGDNTLRALELGAVDFVDKSAAGGAMD
ISVLARELISKIRMAAQVDVDKLRVGEGREVSPPVQVVAEKRETEVVLIGTSTGGPPALQ
NILTRIPASFPCPILIVQHMPAGFTAPLAERLDRLCAVPVKEAKNDEAVMPGTVYIAPAG
SHLKLKREGNHLLVVLDSLPEGTLHRPSVDVLFESAAAACGGKILSFVLTGMGRDGASGA
KAVKDAGGKVFIESEKTCIVFGMPKAVMDTVNIDGEILLDKVAETMIRSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaatgggcaacggaaaatacgggtgttggtggtcgatgattcggccttcgtg
agaagggccatagtccggatgttcgagaacagttcggacatccaggtcattgatgtggcc
tccaatggagaaatggccatagatatgatcaaatccctgaaaccggacgtggtgaccctg
gatgtgaagatgccggttttggatggtctgtccgccctggaaaggatcatgaaggaatgc
ccggcgccggtgatcatgctcagctccctgatggagaaagggggcgacaacacactgcgc
gccctggaactgggggcagtggattttgtcgacaaatctgccgcaggcggtgctatggat
atttccgtgcttgcccgggaactgatctccaaaatcaggatggcggcccaggtggatgtg
gacaaactccgggtgggggagggaagagaggtctcgccgccggtccaggtggtggcggaa
aagagggaaacggaggtcgtgctgatcggtacatcgacaggtgggccaccggcattgcag
aacattctgaccaggattcccgcttctttcccctgtcccatactgatcgtccagcacatg
cctgccggtttcactgcgccattagcggaacggctcgatcgcctttgtgctgtacctgtc
aaggaagcgaaaaacgatgaggcggtaatgcccggtacggtctatatcgctccggccgga
agtcacctgaagttgaaaagggaggggaatcacctgctcgttgtcctggattcccttccg
gaggggacgttgcaccggccctcggtagatgtgctctttgaatcagcagcagctgcctgt
ggcggtaaaatcctttcctttgtcctgaccggaatgggcagggatggagcctcgggcgcc
aaagccgtcaaggatgcaggaggcaaagtttttatcgagtcggagaaaacctgtatcgtt
ttcggcatgcccaaagcggttatggatactgtaaatatagatggtgaaattcttctcgac
aaggtggcagagaccatgatccggtccttttga

DBGET integrated database retrieval system