KEGG   Geobacter sp. FRC-32: Geob_3433Help
Entry
Geob_3433         CDS       T00846                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
geo  Geobacter sp. FRC-32
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:geo00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3795818..3796420
Genome map
AA seq 200 aa AA seqDB search
MPVKIETKPALLIVDVQRDFCPGGMLAVAKGDRIIPALNGYCELFRKKNRPIFFSRDWHP
QETSHFEAFGGAWPVHCVMGSKGAEFHPALKVPEVATIISKGMNPSRDDYSAFDGVDDSG
TPFPELLRRLDVDTIYIGGLATDYCVKESALAALRQGFSVTLLEDAVRGVDLKPGDSSKA
IAEMKTTGAKTTNLSTIDLG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcaaaattgaaactaagccggcactgctgattgtggatgtgcagagagacttc
tgcccgggaggtatgctggccgtagccaaaggtgaccgaatcattccggctctaaacgga
tactgcgagctgttccgcaagaagaaccgacctattttcttttccagggactggcacccc
caagaaacgtcgcacttcgaggcctttggcggtgcctggccggtacactgcgtcatggga
agcaaaggagcggaatttcatcctgccctcaaggtgccggaggtggctacgatcatctcc
aaaggtatgaatccatcacgggatgactattctgcctttgacggcgtcgacgactccggc
actccttttcctgagcttttacggcgtctggatgtggatacaatatacatcggcggactg
gccactgattattgcgtcaaagagtcggcattggcagcgctgcggcaggggttttccgta
accttactggaagacgccgtccgtggagtggatctcaagccgggcgacagctcaaaggct
attgctgagatgaaaacaaccggggccaaaaccacaaacttgtccactattgatttaggc
tga

DBGET integrated database retrieval system