KEGG   Geobacter daltonii FRC-32: Geob_3437Help
Entry
Geob_3437         CDS       T00846                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
geo  Geobacter daltonii FRC-32
Pathway
geo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
geo01100  Metabolic pathways
geo01110  Biosynthesis of secondary metabolites
geo01130  Biosynthesis of antibiotics
geo01230  Biosynthesis of amino acids
Module
geo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Geob_3437 (trpC)
Enzymes [BR:geo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Geob_3437 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACM21780
JGI: Geob_3437
UniProt: B9M5M1
Position
complement(3800070..3800873)
Genome map
AA seq 267 aa AA seqDB search
MADAPDILKKIVAHKKMELAAVKGARPLAEVQARLADLEDQPRGFEQALRNAGESGWTAI
IAEVKKGSPSKGLIRADFDPVEIAAVYEKNGAACLSVLTEEHFFLGHLSYLALIREQVGL
PLLRKDFIFDPYQIYEARAAGADAVLLIAAMLDIHQLRGLSALAKELSLDVLLEVHDRAE
LETALETDCTLIGINNRDLRTFVCDLAVTEGLAPLVPPERLIVAESGIHFRADVIRLQHA
GAGAFLIGESLMREPDMGAKLRELLTE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcaccggacattctgaagaaaatagtcgcccataaaaagatggagcttgct
gccgtgaaaggggcaaggcctctggcggaggtgcaggcgcgccttgccgacctggaagac
cagccgcggggatttgagcaggcattgagaaatgcaggcgaatccggctggaccgccatc
atcgccgaagtcaagaagggttctccgtcaaaaggcttgatccgggccgatttcgatccg
gtggagattgctgccgtttatgaaaaaaatggcgccgcctgcctgtcggtgctgaccgaa
gaacattttttcctgggacacttgagctatctggctcttattcgtgagcaggtgggctta
cccctgctgcgcaaggattttatctttgacccataccagatctatgaggcccgtgctgcc
ggagctgatgcggttcttctcatcgctgccatgctcgatattcaccagttgcggggcttg
tcggccctggcaaaagagttgtcccttgacgtgctgcttgaggtccacgaccgggccgag
ctggaaacggcacttgaaaccgactgcaccctgatcggcatcaacaaccgggatctgcga
accttcgtctgtgaccttgccgttacggaagggctcgctccgctggttccgccggagagg
ctgattgtggcggagagcggtattcatttcagggcagatgtgattcgtctgcagcatgcc
ggcgctggtgcttttctcatcggggagtcgctgatgcgggagccggatatgggggcgaag
ctgcgggagcttctcaccgagtag

DBGET integrated database retrieval system