KEGG   Geobacter sp. FRC-32: Geob_3663Help
Entry
Geob_3663         CDS       T00846                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
geo  Geobacter sp. FRC-32
Brite
Enzymes [BR:geo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Geob_3663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4064284..4065270
Genome map
AA seq 328 aa AA seqDB search
MKVFITGATGFIGASIVRELLKDGATVKALARAGSDRSNINGLDVEICEGDLCTPESLEK
GIRGCDMVFHAAADYRLWTKKPSQMYEINVNGTRNVLAAALKAEVSKVVYTSSVGTLGNP
GDGNPGNESTPVSLVDMVGHYKKSKFLAEREAESFIAKGLPLVIVNPSTPVGRLDIKPTP
TGKIIVDFLNGKMPAYLDTGLNIIDVEDCARGHILAAQKGRIGEKYVLGNKNLSLKQIFA
SLEEITRLPAPRVRLPYYPILFAAYANEALAALTGKEPLIPLAGVQMARKFMFFDSSKAV
EELGLPQNSVADALAKAVEWFRLEGYAR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttcatcaccggagcaaccggtttcataggcgcaagcatcgtcagggaacta
ttgaaggacggagctacagtcaaggccctggccagggcaggctccgaccgcagcaacatc
aatgggctcgacgttgaaatatgcgagggggatctctgtacccctgagtccctggaaaag
ggcatcaggggctgcgatatggttttccatgccgcagccgactaccggctatggacgaaa
aaaccgtcgcagatgtacgaaatcaacgtaaacggcacccgtaatgtccttgctgccgca
ctcaaggccgaggttagtaaggtagtttacaccagcagcgtcggcaccctgggcaatccg
ggcgatggcaatccgggtaacgagtcgacacctgtaagccttgtcgacatggtcggccat
tacaagaaaagcaagtttctcgccgagcgggaagcggaatccttcatcgccaagggactg
ccgctggtcatcgtcaatccgtccacgccggtcggcagacttgacatcaaaccgaccccc
accggcaaaattatcgtcgatttcctcaacgggaaaatgccggcatacctggataccggc
ctcaacattattgacgtggaagattgtgcccgtggccatatcctggctgcccaaaaaggg
cgcatcggcgaaaaatacgtcctgggcaacaagaacctgagcctgaagcaaatattcgcc
tcgcttgaggaaatcaccaggctcccggcacccagggtcagactcccctactatcccatt
ctttttgccgcgtacgccaacgaggcactggcggcattgaccggcaaggaaccgcttata
cctctggccggtgtgcagatggcacgcaaattcatgttcttcgactcttccaaggctgta
gaggaactggggctgccgcagaattctgtagccgacgccctggcaaaagcagtagaatgg
ttccggcttgaaggctatgccaggtga

DBGET integrated database retrieval system