KEGG   Geobacter sp. FRC-32: Geob_3733Help
Entry
Geob_3733         CDS       T00846                                 

Definition
uracil-DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
geo  Geobacter sp. FRC-32
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:geo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Geob_3733
Enzymes [BR:geo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Geob_3733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4161580..4162296
Genome map
AA seq 238 aa AA seqDB search
MNLLSISETLAEKLDRLEFSRPVAHVYNPLRYAWRPHREYLNRYGGTGKKAVLVGMNPGP
WGMTQTGVPFGEVAVVRDWLRIADPVERPGLEHPKKPVQGLNCPRSEVSGKRLWGMIRER
FETPAQFFKDYLVLNYCPLLFLDAQGTNLTPDKLPSVERHALEDACNGAFRHMIEYLKPE
FVVGVGNFAAIQAETALQGLPVNVTKILHPSPSSPAANRGWSEVALRQLSEAGIGFQP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttttaagcataagcgaaactctggcagaaaagcttgaccggctggaattctcc
cgtccggttgcccatgtgtacaacccgttgcgttatgcctggcggccacaccgggagtac
ctgaaccgctatggaggaacagggaagaaagcggtgctggtcgggatgaatcccgggccg
tggggcatgacccagaccggtgtgccgtttggcgaggtggcggtggtgcgggactggctg
agaatagccgatcctgtagaaaggccaggtcttgaacaccccaaaaagccggtccagggt
ctgaactgcccccgcagtgaggtgagcggcaagcgtctatggggcatgatccgtgagcgc
tttgagacacctgcacagtttttcaaggattacctggtccttaactattgtccgctgctc
tttctcgatgcccaggggaccaacctgaccccggacaagcttccgagtgtggaacgtcat
gcgcttgaggatgcctgcaacggggcatttcgtcatatgatcgaatatctcaaacctgaa
tttgttgtaggggttggtaattttgctgcaattcaggcagaaaccgctttacaggggctg
ccggtaaacgtaaccaagatcctccacccaagcccctccagtccggctgcgaaccgggga
tggagtgaggttgcactacggcagctgtctgaagcggggattggattccagccgtag

DBGET integrated database retrieval system