KEGG   Geobacter sp. FRC-32: Geob_3759Help
Entry
Geob_3759         CDS       T00846                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
geo  Geobacter sp. FRC-32
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:geo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geob_3759
   01230 Biosynthesis of amino acids
    Geob_3759
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geob_3759
   00030 Pentose phosphate pathway
    Geob_3759
   00051 Fructose and mannose metabolism
    Geob_3759
   00052 Galactose metabolism
    Geob_3759
  Energy metabolism
   00680 Methane metabolism
    Geob_3759
Enzymes [BR:geo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Geob_3759
Protein phosphatases and associated proteins [BR:geo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Geob_3759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4208152..4209123
Genome map
AA seq 323 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAIVRTGLDKGWEMFGVHNGYAGLISGEIMPLGARDVGGI
IQKGGTMLGSARCREFETEEGRRKALTQMEQQGIGGLIVIGGNGSQTGAYELSRMGFPVV
GVASTIDNDLYGSDITIGVQTAMDVALEAIDRLKVTASSHHRAFLLEVMGRKCGYLALMA
GIAGGAEAIMIPEQKTDPEVVAADLRAAYDNGKAHAIIVVAEGAQNNADGMAQYFQIHRE
RLGFELRVTKLGHVQRGGSPGSFDRILGTQLGAAATESLEKGNKGVLMGMIKGEITATPL
DVVVENKKDLDLRLLELAKVLAK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgccgtactcaccagcggcggcgacgcccctggcatgaacgccgccatt
cgtgccatcgtcaggacgggacttgacaagggttgggagatgtttggcgttcataacggc
tatgccggcttgatcagcggcgagataatgccattgggcgcgcgggatgtgggaggcatc
atccagaagggtggcaccatgctcggtagcgcccgctgccgcgaattcgagaccgaggaa
ggtcgccggaaagccttgacccagatggagcagcagggaatcggcggcctgatcgtcatt
ggcggaaacggctcccagaccggcgcctatgagctgtcccggatggggttcccggtggtg
ggagtcgcctcgaccatcgacaacgatctttacggttcggacattaccatcggcgtccag
accgccatggatgtggcacttgaagcaatcgaccggctcaaggttaccgcctcctcccac
catcgggcttttcttcttgaggtcatggggcgcaaatgcggatacctggcattgatggca
ggcattgccggcggcgccgaggcgatcatgatccccgaacagaagaccgacccggaggtt
gttgctgccgatctgcgagctgcctatgacaacggcaaggcccatgccattatcgttgtt
gccgaaggtgcacagaacaacgccgacggcatggcccagtactttcagatccatcgggaa
cggctcggtttcgagctcagggttaccaagctcggccatgtgcaacgggggggctcgccg
ggctccttcgaccgcatcctcggcacccagctcggtgcagccgccaccgaaagtctggag
aaaggcaacaagggggtcctgatggggatgattaagggagaaatcaccgccactccgctt
gatgtggtggtcgagaacaaaaaagaccttgacttgcgtttgctggaattggcaaaagtc
ctggcaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system