KEGG   Geobacter daltonii FRC-32: Geob_3832Help
Entry
Geob_3832         CDS       T00846                                 

Gene name
cheB64H-1
Definition
(GenBank) protein glutamate methylesterase CheB associated with MCPs of classes 40H and 40+24H, response receiver domain-containing
  KO
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
geo  Geobacter daltonii FRC-32
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:geo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Geob_3832 (cheB64H-1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Geob_3832 (cheB64H-1)
Enzymes [BR:geo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Geob_3832 (cheB64H-1)
Two-component system [BR:geo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Geob_3832 (cheB64H-1)
Bacterial motility proteins [BR:geo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Geob_3832 (cheB64H-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4295647..4296714
Genome map
AA seq 355 aa AA seqDB search
MTPMHQGRLKVLVVDDSCFMRMAIRGILAKDPQIEIVGIAADGIEGIEKAIELRPDIITM
DVEMPRMDGIAALKQIMAKAPTRVLMVSTLTCEGAKATFEALEAGAIDYIPKNISDSSEA
QKVFREELLNKVKQAGSSLVQFGTSVKRSIVPSPAAITKSRFSKRVNCVGIGASTGGPVA
LQEVLSRIPANFPFGIMVAIHMPKAFTGPYAERLNAKCSLEIHEAKDGDILRPGLVLIAP
GGRHTSIIRQGAGLTVKTDPTTLFPQYLYIPSVDQMMHSLAEASNGSMLGVVLTGMGSDG
FKGMQFLKTRGGVTLVQDEATSTIYGMPKACIDGGVADEVLPLEQIGFEIARIAG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatgcatcagggcagattgaaagttctggtcgtcgatgattcttgcttcatg
agaatggcgatccgcggcattctggccaaagacccacagatagaaatagtcggcattgcc
gccgatggaatcgaaggcattgaaaaagctatcgaactgcgtccggatatcattacgatg
gatgtggaaatgccgcgcatggacgggattgctgccctcaagcagatcatggccaaggct
cccactcgggtcctgatggtttcaacccttacctgtgaaggagcaaaagccacctttgaa
gcgctggaagcaggtgcaatcgactatataccaaaaaatatcagcgactcctctgaagcc
cagaaggtcttccgcgaggaactgctgaacaaggtcaaacaagccggcagctcactcgtt
caattcggcaccagtgtcaaacgcagcattgtcccctcccctgccgccattaccaaatcc
agattttctaaacgagtgaactgcgtcggcatcggcgcctcaactggtggtccagttgcc
ctccaggaagtgctttcccgcataccggcaaactttccttttggcattatggtggcaatc
cacatgcccaaggcgtttaccggcccctacgccgaacgtctgaatgccaaatgttcactg
gaaatacatgaagccaaggatggcgatattctgcggccgggactcgttctcattgctccc
ggaggacggcatacatcaataatcaggcaaggagccggcctgactgtaaagaccgatcct
accacccttttcccccaatacctttatattccctctgtggatcagatgatgcacagcctt
gccgaggccagcaacggctcgatgctcggtgtggtgctcaccggcatgggtagcgacggg
ttcaaggggatgcagtttttaaaaaccagggggggggttacactggtgcaggatgaagcg
acctcaaccatctatgggatgcccaaagcctgtatcgatgggggtgttgccgacgaggtt
ctgcctctggagcagataggatttgaaatagcgaggattgccggctga

DBGET integrated database retrieval system