KEGG   Gramella forsetii: GFO_0031Help
Entry
GFO_0031          CDS       T00448                                 

Definition
glycosyl hydrolase (EC:3.2.1.-)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gfo  Gramella forsetii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gfo00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:gfo00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39503..41938)
Genome map
AA seq 811 aa AA seqDB search
MKFPFLRTSILILCLAFCLPVLAQRNLIELQKDWKFAKGEIPTAAETNFNDSNWQDVRIP
HDWAISENFIKDGDGSTGKLQWKGQGWYRKKLDIAPSFKDKRVYLIFDGVMAFPEVYING
KLAGKWDYGYNSFYVDITDHLNFNGENFLAVHADTRKHDSRWYPGAGMYRKVQMLVTNPV
HVDIWGTYVTTPVIKKDSASIRISNKIINTTEKADSVKIYQSILNPEGNEVSKDSVTRFI
AAGGESFLEINTKVSKPQLWDVNQPNLYKTITKVFVGGKQTDEKETTFGIRTIKFTADDG
FHLNGKRVQLKGVNLHHGHGPLGGAFYPRAAERQLEIMQSLGVNAIRNSHNVAAPELLEL
CDKMGILFFNEIFDKYDAKAGIVDTTNFEDFAHRNIKNFVLRDRNHPSVFMWSVGNEIGD
VQWNQNNGFQRLHTMLNYVNKYDPTRPTTLVNDQLKSAELRHFDLYDVHSWNYGRRYRIA
RKLEPNKAVVISESASTLSTRGFYEFPLPEKKTDFTKSLQVSSYDLNAPDWAEIADDDFM
WQQQEPYIAGEFVWTGFDYLGEPTPYTNKEVTEMGMTDLEASRSSYFGIVDLVGIPKDRY
YLYKSYWKPDETTVHILPHWNWEGREGETTPVFVYTNGDCAELFINGKSFGKKCKKLDSE
TSTDRFRLMWKDVTYEPGEVKAVAYKDGKKIGENNIKTAGKTSKISLTADRTSIKADGKD
LSYILVEAFDKDGNPSPLADNELKIEVSGAGHLAGAGNGDPQSFEPFQNNKVNLFYGKAM
IIVGSDFEKGKLKLSVKPENIQKESITINVE
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccttttttaagaaccagtatcctaatcctctgtttagcgttttgtttacct
gtactggcacaaagaaatcttattgaacttcagaaagactggaaatttgccaaaggcgaa
ataccaaccgctgctgaaactaattttaatgattccaactggcaggatgtgcgaattccc
catgactgggcgatttctgaaaatttcataaaagatggagacgggagcacaggaaaactt
cagtggaaaggacagggctggtatcgtaaaaaactcgatatcgccccttcatttaaagat
aagcgagtctatctcatttttgacggagtaatggcgtttcctgaagtttacatcaatggt
aagcttgccggaaaatgggattatggttataactcattttatgttgatatcacagatcac
ctgaatttcaacggagaaaactttcttgcggttcatgcagatacccgcaaacatgacagc
cgctggtatcccggagccggaatgtaccgaaaagtacaaatgctggtaaccaatcccgta
catgtggatatatggggaacctatgtcaccacaccggttatcaaaaaagatagcgcgagt
ataagaataagcaataagatcatcaatactactgagaaagcagattcggtaaaaatatac
cagagcattcttaatcctgaaggaaatgaagtttcaaaagattctgttacgcgttttatt
gcagccggtggtgaaagctttctggaaataaatacaaaagtttccaagcctcaactatgg
gacgtcaatcagccgaatttatataaaaccattaccaaagtatttgtaggcggtaaacaa
accgatgaaaaggaaaccaccttcggaattcgaactataaaattcacggcagatgacggt
tttcatttaaatgggaaacgggttcagttgaaaggagtaaatctgcatcacggtcacgga
cctttgggtggggctttttacccaagagctgctgaaagacaactggaaattatgcaatcc
ctgggtgtaaacgccatcaggaacagtcataacgtcgctgccccggaattgctggaactt
tgcgataaaatgggcatcctgttctttaatgagatcttcgataaatatgatgccaaggca
gggattgtagataccaccaattttgaagatttcgcacatagaaatatcaagaatttcgtg
ttgcgtgaccgtaatcatccttcagtattcatgtggagcgtaggtaacgaaattggtgac
gtacaatggaaccagaataacggttttcaaagactgcataccatgttgaattacgtaaat
aaatatgatcccaccaggccaactaccctggtgaatgatcagctaaaaagtgccgaatta
cgtcattttgacctttacgatgtgcatagctggaattacggcaggcgctatagaattgcc
agaaaactcgaaccgaataaagctgtggtgattagtgaatcggcttcaaccttaagcaca
aggggcttttatgaatttccgttaccggaaaagaaaaccgatttcaccaaatctttgcag
gtaagttcctatgatctgaacgctccggattgggccgaaattgccgatgacgattttatg
tggcaacaacaggaaccttatatcgccggagaattcgtctggactggttttgactattta
ggagaaccaacaccttataccaataaggaagtcactgaaatgggtatgaccgatttggaa
gcttcacgtagttcctattttggaattgtggatctggtaggtattcccaaagaccgttat
tatttatataagagttactggaagcctgatgaaactactgttcatattctaccccactgg
aactgggaaggtcgtgaaggcgaaaccacaccggtttttgtttataccaatggcgattgt
gctgaactttttataaacggaaagtctttcggaaaaaaatgtaaaaaattagattctgaa
acctctaccgatcgttttcgtttgatgtggaaggatgtaacctatgaacccggcgaagta
aaagccgttgcttataaagacgggaagaaaattggtgaaaacaacattaaaacagccgga
aaaacatcaaaaatcagccttactgcagatagaacatctataaaagctgatggaaaagat
ctttcttatatcctggtggaagcttttgataaagatggcaacccgtctcctctggccgat
aacgaactgaaaattgaagtttcgggggctggacatttagccggtgcaggaaatggagat
ccacaatcctttgaaccatttcagaataacaaagtgaatttattttacggaaaagctatg
attattgtaggctccgattttgaaaaaggcaagttaaaactctcagtaaagcctgaaaat
attcaaaaagaatctatcactatcaatgtggaatag

DBGET integrated database retrieval system