KEGG   Gramella forsetii: GFO_0043Help
Entry
GFO_0043          CDS       T00448                                 

Definition
phospholipase A1 (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
gfo  Gramella forsetii
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GFO_0043
   00565 Ether lipid metabolism
    GFO_0043
   00590 Arachidonic acid metabolism
    GFO_0043
   00591 Linoleic acid metabolism
    GFO_0043
   00592 alpha-Linolenic acid metabolism
    GFO_0043
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     GFO_0043
    3.1.1.32  phospholipase A1
     GFO_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(59726..60559)
Genome map
AA seq 277 aa AA seqDB search
MNKIFSSFVLIGLTFLSSNSFAQGITKKSVDSIIKEASAFSIHKDNYFISGIPLNQEINK
TTADAKYQISFKQLMTRNSLPGDTYLFLTYTQKAFWNIYENSSPFQELNFNPAVGLGKPI
YNQEKHLSGIASLMLAHESNGRDSIFSRSWNSVRLKYSTLLSPRTTFTVETWIPFLYKDG
NPDLFDYLGPAEINVEQVFIPKKLTAELMLRKGLEWNWQGAYRARIFYRPFKMSNQYFML
EWFNGYAESLINYREHVNMLRIGYVIKTKELDILKKQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatattctcctcatttgttttaattggcctcacttttttatcttcaaattct
tttgcccagggtattacgaaaaaaagtgtagactccatcattaaggaggcttctgcgttt
tcgatacataaagacaattattttatttcgggaatacctttaaatcaagaaattaacaag
actactgcagatgctaaatatcagataagctttaagcagcttatgacccgaaattcgtta
cccggggacacctatctttttctaacgtatacccaaaaggcattctggaatatttacgaa
aattcgagtccgtttcaagagcttaatttcaatccggctgttggtttaggcaaacctata
tataaccaggagaaacatctctcgggaattgcttcacttatgttagctcatgaatctaat
gggcgtgacagtattttttcccgaagctggaatagtgtaaggctaaaatattctacgttg
ttaagtcccagaactacattcacagtagaaacatggatcccttttttatataaagatggc
aacccagatctttttgattacctgggcccagcagaaattaatgtagaacaggtttttatt
ccgaagaaacttactgcagagctaatgctaagaaaaggtttggaatggaactggcaggga
gcttatagagcaaggattttttaccgaccttttaaaatgtctaatcaatattttatgctg
gaatggttcaatggatatgcagagagtcttataaattacagggaacatgtgaacatgctc
cggattggatatgtcatcaaaacaaaagaactggatatcttgaaaaagcaatag

DBGET integrated database retrieval system