KEGG   Gramella forsetii: GFO_0432Help
Entry
GFO_0432          CDS       T00448                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gfo  Gramella forsetii
Pathway
gfo00010  Glycolysis / Gluconeogenesis
gfo00051  Fructose and mannose metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
gfo01200  Carbon metabolism
gfo01230  Biosynthesis of amino acids
Module
gfo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gfo_M00002  Glycolysis, core module involving three-carbon compounds
gfo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFO_0432 (tpiA)
   00051 Fructose and mannose metabolism
    GFO_0432 (tpiA)
   00562 Inositol phosphate metabolism
    GFO_0432 (tpiA)
Enzymes [BR:gfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GFO_0432 (tpiA)
Exosome [BR:gfo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GFO_0432 (tpiA)
  Exosomal proteins of bladder cancer cells
   GFO_0432 (tpiA)
  Exosomal proteins of melanoma cells
   GFO_0432 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAL65416
UniProt: A0LYH1
Position
507606..508385
Genome map
AA seq 259 aa AA seqDB search
MKYKTKFQIMRDHIVAGNWKMNNDLAETQELLGKLKLQMVKEPEATVMVAPSFTNLYPTF
QSLKDTPVIVAAQNMHESEKGAFTGEVSASMLKSIGVTTVIIGHSERRALFNETNDILAK
KVQAAIENDMTVIFCFGEELEDRKSEKHFNLVEKQLKESLFQLPQSVWKNIILAYEPVWA
IGTGETASPEQAQEMHKHVRELLNKNVGKEVAEATSILYGGSVKPNNAKEIFAKEDVDGG
LIGGASLNAVDFLEIVNSF
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataaaacaaaatttcaaatcatgagagatcatatagttgccggaaactggaaa
atgaacaatgacctggcagaaactcaagaacttctagggaagttaaaacttcaaatggtt
aaagaaccagaggctacggtaatggttgctccatctttcacaaatttatatccaacgttt
caatctcttaaggatactccggtaattgtggctgctcaaaatatgcatgaaagtgagaaa
ggtgcatttaccggtgaagtttctgcaagtatgctcaaaagtattggagttactacggta
attataggacatagtgagcgaagagctctttttaatgagaccaatgatattttggctaaa
aaagtacaggctgctattgagaatgacatgacggtgatcttttgttttggagaagaatta
gaagatcgaaaaagcgagaaacattttaatcttgtagaaaagcaattaaaggaaagtctt
tttcaattacctcagagtgtctggaagaatattattcttgcctatgagcctgtttgggct
attggtaccggagaaactgcaagtccggaacaagctcaggaaatgcataaacatgtaagg
gagcttttaaataaaaatgtagggaaagaagtagcagaagctacttcaatattatacggt
ggtagcgtaaaacctaacaacgccaaagagatttttgcaaaagaagatgtagacggtggc
cttattggtggagcaagtctcaatgcagtagacttcctggagattgtaaattcattttag

DBGET integrated database retrieval system