KEGG   Gramella forsetii: GFO_0789Help
Entry
GFO_0789          CDS       T00448                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gfo  Gramella forsetii
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GFO_0789
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GFO_0789
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GFO_0789
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GFO_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879112..880128
Genome map
AA seq 338 aa AA seqDB search
MKILFKILPVLFLILSCGSSSSANKETESDFVIAFGSCNREDESQLLWKPILKNHPDVFL
WGGDNIYSDTDNAEIMKAAYQKQKNNRNYQKLLNQVPVLGIWDDHDYGLNDGGEEWHFKN
RSQQLFLDFMEVSEESPRRSREGIYHSEIFKTEKGNVKVILLDTRYFRDELIKSEDPNKR
YEPSTGTVLGEEQWSWLEAELGNSEVDFNVILSSIQILSAEHGFETWGNFPMEVEKLKDL
IVASKVKNVILLSGDRHISEFSATEVSGLNYPLIDFTSSGLTHTYEEFSGEPNQYRVGEV
VKNKSFGMLRFNFDKNEVRLEMRGLNNKLQQDYLLEFQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattattcaaaatattacctgtactttttctaatcttatcctgcggaagttca
tcttcggcaaataaagaaactgaatcagatttcgtcattgcttttggaagttgtaatcgg
gaggatgagtcacaattgttatggaaacctattctgaaaaatcatcccgacgttttttta
tggggcggagataatatttattctgataccgataatgctgaaattatgaaagctgcatat
cagaaacaaaaaaataatcggaactatcagaaattacttaatcaagtgccggtacttgga
atatgggatgatcatgattacggactgaatgatggtggtgaagaatggcattttaaaaat
agaagtcagcagttattcttagactttatggaggtttctgaagaaagtccgcgcaggagt
agggaaggcatttatcattctgaaatttttaaaactgaaaaagggaatgtgaaagtaatt
ttattggatacgaggtacttcagagatgaattgatcaaaagcgaagatcctaataaaaga
tatgaaccttcaacaggaacagtgcttggagaagaacagtggagctggctggaagcggaa
cttggaaatagtgaggtagattttaacgtaattctttccagtattcagatactatcagca
gaacacggatttgaaacctggggaaattttcctatggaagttgaaaaattgaaggatctt
attgttgcttctaaagttaaaaatgtaattctgttaagtggtgatcggcatatttcagaa
ttttcagcaaccgaagttagtggtctaaattatcctttaattgattttacttccagcgga
cttacgcatacctacgaagaattcagcggagaacccaatcaatatagagtaggagaggtg
gtgaaaaataaaagttttgggatgttaagattcaattttgataagaatgaagtacgtctt
gaaatgagaggattgaataataagttacagcaggattatttgcttgaatttcagtag

DBGET integrated database retrieval system