KEGG   Gramella forsetii: GFO_1535Help
Entry
GFO_1535          CDS       T00448                                 

Gene name
res
Definition
helicase-like protein (EC:3.1.21.5)
Orthology
K17677  
ATP-dependent helicase IRC3 [EC:3.6.4.-]
Organism
gfo  Gramella forsetii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1585335..1586897
Genome map
AA seq 520 aa AA seqDB search
MLKMAYFCKIAYLKKSMASETFGIEKKKVDKELYDYQQKDIDKIFGVIEEHPENYNLLYQ
LPTGGGKTVIFSQMTREYIQRTNKKVLILTHRIELCKQTSKMLSGFGVRNKIINSKVKEL
PDQDDYMCFVAMVETLNNRLNDEKLEIQDIGLVIIDEAHYNSFRKLFKFFEKCFILGVTA
TPLSSNIKLPMKDNYRELIVGDSISSLIEKGFLAQVNIYSYNVGLTNLKVGMNGDYTVKS
SEELYSNYSMQEKLLTAYYERSKGKKTLIFNNGINTSVEVYYTFKNAGLPIRHLDNTTSK
QDRKDILKWFKHTPDAIVTSVSILTTGFDEPTVETIILNRATKSLTLYFQMIGRGSRVLK
NKDEFNVIDLGNNLARFGHWSTAVDWKQIFRSPDFYFENLLSDEDIERDFQYQMPPEIRE
QFSKSEDVTFDIEEAYDIVIKKGLKSKAVLEWSMEQHVKMCVENSEDVFDARILAKELKD
DISSRIKQYSYCISKSTKNYRDWLEEDYSRKLRMEINKEF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaatggcttatttttgcaaaattgcttacttaaaaaaatctatggcgtcagaa
acatttggtattgaaaagaagaaagtagacaaggagttatatgactaccaacaaaaagat
atagataagatattcggcgtaattgaagaacatcctgaaaactataaccttctttatcaa
ctacctaccggtggtggaaaaacggtgattttctctcaaatgacaagggagtatatccag
agaacaaataaaaaagttcttatacttacgcacagaattgaactttgtaagcaaacttct
aagatgctttcagggtttggagtgcgcaataagatcattaatagcaaggtaaaggaatta
ccagatcaggacgattatatgtgttttgttgccatggtggaaacactaaataatcgattg
aatgatgaaaaactggaaattcaggatattggattggtgattattgatgaagcacattac
aactcatttagaaaattattcaagttctttgaaaagtgttttatccttggagtaacagca
actccattaagttccaatattaaacttccgatgaaagataactacagggagcttattgtt
ggggattctatttcttctttaatagaaaaaggctttctagctcaggttaatatttatagt
tataatgtgggattaaccaatcttaaagtggggatgaatggtgattacaccgtaaaatct
tctgaagagttatattctaattatagcatgcaggagaagcttctcactgcttattatgag
aggtctaaaggtaaaaagacgctgatcttcaataatggtatcaacacctctgtagaggtc
tattatacttttaaaaacgcaggtttgcctattaggcatctggacaatacaacgagtaag
caggaccggaaagacattctaaaatggttcaaacatacaccagatgctattgttacttca
gtaagtattcttactacaggatttgatgagcctacagtagaaacgattattctaaatcgt
gccacaaaatcacttacactttatttccaaatgattggccgtggttcacgtgtgctaaag
aataaagatgagtttaatgtaatagatctagggaataatttggctagattcgggcattgg
agcactgcggtagattggaaacaaatatttagatctcccgatttctattttgaaaatctt
cttagtgatgaagatattgaaagagattttcagtatcaaatgcctcctgaaattcgagag
caattttccaaatctgaagatgtcacttttgacattgaagaagcttatgatatagtgatc
aaaaaaggtctgaaatctaaagctgttttggaatggtctatggagcaacacgtaaagatg
tgtgttgaaaatagtgaagatgtatttgacgcaaggatcctcgcgaaggaattaaaggat
gatatttcttcccgtataaagcaatattcttactgtataagtaaaagcaccaagaattat
cgtgattggctggaagaagactattcgcgtaaacttaggatggagatcaataaggaattc
tag

DBGET integrated database retrieval system