KEGG   Gramella forsetii: GFO_1535Help
Entry
GFO_1535          CDS       T00448                                 

Gene name
res
Definition
(GenBank) helicase-like protein-possibly a type-III restriction enzyme
Organism
gfo  Gramella forsetii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII Helicase_C DEAD AAA_22 AAA_30 DUF2075
Motif
Other DBs
NCBI-ProteinID: CAL66508
UniProt: A0M1L3
Position
1585335..1586897
Genome map
AA seq 520 aa AA seqDB search
MLKMAYFCKIAYLKKSMASETFGIEKKKVDKELYDYQQKDIDKIFGVIEEHPENYNLLYQ
LPTGGGKTVIFSQMTREYIQRTNKKVLILTHRIELCKQTSKMLSGFGVRNKIINSKVKEL
PDQDDYMCFVAMVETLNNRLNDEKLEIQDIGLVIIDEAHYNSFRKLFKFFEKCFILGVTA
TPLSSNIKLPMKDNYRELIVGDSISSLIEKGFLAQVNIYSYNVGLTNLKVGMNGDYTVKS
SEELYSNYSMQEKLLTAYYERSKGKKTLIFNNGINTSVEVYYTFKNAGLPIRHLDNTTSK
QDRKDILKWFKHTPDAIVTSVSILTTGFDEPTVETIILNRATKSLTLYFQMIGRGSRVLK
NKDEFNVIDLGNNLARFGHWSTAVDWKQIFRSPDFYFENLLSDEDIERDFQYQMPPEIRE
QFSKSEDVTFDIEEAYDIVIKKGLKSKAVLEWSMEQHVKMCVENSEDVFDARILAKELKD
DISSRIKQYSYCISKSTKNYRDWLEEDYSRKLRMEINKEF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaatggcttatttttgcaaaattgcttacttaaaaaaatctatggcgtcagaa
acatttggtattgaaaagaagaaagtagacaaggagttatatgactaccaacaaaaagat
atagataagatattcggcgtaattgaagaacatcctgaaaactataaccttctttatcaa
ctacctaccggtggtggaaaaacggtgattttctctcaaatgacaagggagtatatccag
agaacaaataaaaaagttcttatacttacgcacagaattgaactttgtaagcaaacttct
aagatgctttcagggtttggagtgcgcaataagatcattaatagcaaggtaaaggaatta
ccagatcaggacgattatatgtgttttgttgccatggtggaaacactaaataatcgattg
aatgatgaaaaactggaaattcaggatattggattggtgattattgatgaagcacattac
aactcatttagaaaattattcaagttctttgaaaagtgttttatccttggagtaacagca
actccattaagttccaatattaaacttccgatgaaagataactacagggagcttattgtt
ggggattctatttcttctttaatagaaaaaggctttctagctcaggttaatatttatagt
tataatgtgggattaaccaatcttaaagtggggatgaatggtgattacaccgtaaaatct
tctgaagagttatattctaattatagcatgcaggagaagcttctcactgcttattatgag
aggtctaaaggtaaaaagacgctgatcttcaataatggtatcaacacctctgtagaggtc
tattatacttttaaaaacgcaggtttgcctattaggcatctggacaatacaacgagtaag
caggaccggaaagacattctaaaatggttcaaacatacaccagatgctattgttacttca
gtaagtattcttactacaggatttgatgagcctacagtagaaacgattattctaaatcgt
gccacaaaatcacttacactttatttccaaatgattggccgtggttcacgtgtgctaaag
aataaagatgagtttaatgtaatagatctagggaataatttggctagattcgggcattgg
agcactgcggtagattggaaacaaatatttagatctcccgatttctattttgaaaatctt
cttagtgatgaagatattgaaagagattttcagtatcaaatgcctcctgaaattcgagag
caattttccaaatctgaagatgtcacttttgacattgaagaagcttatgatatagtgatc
aaaaaaggtctgaaatctaaagctgttttggaatggtctatggagcaacacgtaaagatg
tgtgttgaaaatagtgaagatgtatttgacgcaaggatcctcgcgaaggaattaaaggat
gatatttcttcccgtataaagcaatattcttactgtataagtaaaagcaccaagaattat
cgtgattggctggaagaagactattcgcgtaaacttaggatggagatcaataaggaattc
tag

DBGET integrated database retrieval system