KEGG   Gramella forsetii: GFO_1574Help
Entry
GFO_1574          CDS       T00448                                 

Definition
zinc-type alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
gfo  Gramella forsetii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GFO_1574
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFO_1574
  Lipid metabolism
   00071 Fatty acid degradation
    GFO_1574
  Amino acid metabolism
   00350 Tyrosine metabolism
    GFO_1574
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GFO_1574
   00626 Naphthalene degradation
    GFO_1574
Enzymes [BR:gfo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GFO_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1629957..1630964)
Genome map
AA seq 335 aa AA seqDB search
MKAVGFKKSLSIEKENSFIDFEIDKPKPQKRDLLVKIKAISVNPVDYKVRQSAAKDSELD
NPKIIGWDASGVVEAVGDDVEMFKVGDEVYYSGDLTRPGCYSEFQLVDERIVGYKPDNLN
WEEAAALPLTSLTAWESIFDRLRIKENEGKAKTVLIIGGAGGVGSIAIQILKQLTNFKVI
ATASRDITKKWCEKMGADKIVDHHNLMDSMGDTRNVDYILNFADTSGNWKAMTELIAPQG
GICCIVNTTENVDLNLMKEKSVSFHWELMFTRSMFKTDDMIMQHEILNKVRKLIEANKIK
TTLNETFEGLSAETLKKVHKLQESGKSVGKNVISF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaggtttcaaaaagtcgttatccattgagaaagaaaatagttttatcgat
tttgaaattgataaaccaaaaccacaaaagagagatctcctggttaagattaaagcgatt
tcagtgaatcctgtagattacaaggttcggcaaagtgcagcaaaggattcagaattggat
aatccaaaaataattggctgggatgcttcaggagttgtagaagccgtaggcgatgatgtt
gaaatgtttaaggttggtgatgaagtatattactcaggcgacctaacgcgtccaggatgt
tattccgaatttcagttagttgatgaaagaattgttggttataaacctgataatttaaat
tgggaagaagccgctgctttgccccttacctctttgacagcctgggaatctatatttgat
agattaagaattaaagaaaatgagggtaaagctaagactgtacttattataggcggtgcc
ggtggtgttggatccatcgcgatccaaattcttaaacagctaactaattttaaggtcatt
gcaacggcatcccgggatattaccaaaaaatggtgtgagaaaatgggagctgataaaatt
gtagatcatcataatcttatggatagtatgggagatactcgaaatgtagactacattctt
aattttgctgatacttctggaaactggaaagcaatgaccgaattgattgcgcctcagggt
ggaatttgttgtattgtgaatactactgaaaatgtagatttaaacctgatgaaggagaaa
agtgtaagttttcattgggaacttatgtttaccagaagtatgtttaaaactgatgacatg
ataatgcagcatgaaattctgaataaggtaagaaagcttattgaggccaataagataaaa
actactttgaatgaaacattcgagggtttaagtgcagaaactctgaaaaaagtacacaaa
ctacaggaatcaggaaaatcggtaggaaagaatgtgatttccttttag

DBGET integrated database retrieval system