KEGG   Gramella forsetii: GFO_1738Help
Entry
GFO_1738          CDS       T00448                                 

Gene name
lacZ
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gfo  Gramella forsetii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GFO_1738 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    GFO_1738 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GFO_1738 (lacZ)
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     GFO_1738 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815755..1818913
Genome map
AA seq 1052 aa AA seqDB search
MSIFNILQIMKNQLYCFLSLVLLCTNTIAQERKPYEDHTVFQINKLDPRADFFAFETEVL
AEKGKKELSERFISLNGKWDFKWVKSLNDRPENYYVTEINTEGWGKINVPGNWETQGYGN
PIYLDERYPFEETWPDIPYEYNPVGTYRKNIEISSEVIKNNTIILHFAGAKAMEVYLNGE
FVGYSEGSKTPAEFDITNLVKNGKNMLALQMVRWSDASYLESQDMLRMSGIERDVYLYSI
PKVQVQDIGIKAGLVNNYQNGEFKATFFLKNTSEKNQKAELWVKLKDQNGKIVYSASEEI
FIIKNDSLEKTFFEELKNVKKWSAEIPNLYTLEFGLHPDNDISPSFISKKVGFRSVEIKE
NQLLVNGNPIYIKGVDRHETDPFTGHVVSRESMEKDIRLMKQNNINAVRSSHYPNDPYWY
DLTDKFGLYVIDEANIESHPLAIDEKTQIGNEESWIPAHSERTKRMFYRDRNHPSIIIWS
LGNEAGHGKVFETTYQWLKDHDSRPVQYEPAKTEHYTDIYCPMYPSPEHLEDYAKSNPQK
PAIMIEYAHAMGNSVGNLQDYWDIIENYDVLQGGFIWDWVDQALEYKYPDGKPYLAYGYD
YHPDLPTDGNFLNNGLVDPYRNPHPHLSEVKKVYQPVEFKFDKASSILQIFNKNFFKTFD
DEQIIWKLLENGKSIDSGRVSLNEIKPRTEQDYQLKFDRASSDKNELILQVYLKTDSEEV
LLPADHLLAFEEFLLSAFEGSDFKPVSNDDVNITSQHNTILIKGNNFQLSLDKISGEIKE
WRYNNKLITNEPIHLNFWRAPTDNDLGNGMDKWAKIWKTATHNYTSKLTKQPVLNNKTVA
FEVAYKLPENIAKINVVYEVNSNGDLKINYKFEPLKEELPNIPRIGMYMILPSDFKEVSW
YGKGPGETYWDRKTGQQTGIYSGKIEDQFHRYLRPQETGNKTEVRWMKLESEGLTLSAFA
TNSLLNSSIWPFEMAEIDLEENEIAASASGLVPVTKKHGADIEFGENMQWNIDHLQMGVG
GDTSWGRLVHPEYTIQPKSYSYSFIIRPTQKR
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatttaatatccttcaaataatgaaaaatcaactatactgctttttatcgctc
gtgctgctttgcacgaatacaattgcccaagaaagaaaaccttatgaagaccataccgtt
tttcaaatcaacaaacttgacccaagagccgattttttcgcttttgaaaccgaagttttg
gccgaaaaaggcaaaaaagaactttcggaaaggtttatttccctgaacgggaaatgggat
tttaaatgggtaaaatctttaaacgaccgaccggagaattattatgtaactgaaataaat
acagaaggatggggcaaaattaatgttccggggaattgggaaacccagggatatggcaat
cccatttatcttgatgagcgttatccttttgaagaaacctggccagatattccttatgaa
tataatcctgtgggcacctatcgtaaaaacattgaaatatcttcagaagttattaagaac
aacacaattatccttcactttgccggtgcaaaagctatggaagtttacctgaacggggaa
ttcgtaggatattcggaaggttcaaaaacccccgcagaattcgatatcacaaatcttgtg
aaaaatggcaaaaatatgctagcgttgcagatggtgcgttggagcgacgccagttatttg
gaaagtcaggatatgttaagaatgagcggaatagaacgggacgtttacctttatagtatt
cccaaagttcaagttcaggatattggaattaaagcaggtctggtaaataactatcagaac
ggagaatttaaagcgactttctttctaaaaaatacttctgaaaaaaatcagaaagcagaa
ctttgggtaaaactgaaggatcaaaatgggaaaattgtctattcagcttcagaagaaata
tttataataaagaatgattccctagagaaaactttttttgaagaacttaaaaatgtaaaa
aaatggtcggcagaaattccaaacctttatacgctggaatttggattacacccggacaat
gatatctccccttcttttatttcaaagaaagtcggtttccgttccgtagaaataaaggaa
aatcaattactggtaaatggaaatccaatttacataaaaggtgtagacaggcatgaaacc
gatccgtttaccggacatgtggtaagcagggaaagtatggaaaaagatatccggttgatg
aaacaaaataatattaacgcggtaaggagtagccactaccccaacgatccttattggtat
gatcttactgataaattcggactgtatgtgattgatgaagctaatatagaaagtcatcct
ctggcgattgatgaaaaaacccaaatagggaacgaagaaagctggattcctgctcattcg
gagcgtacaaaaagaatgttttacagagatagaaaccatccttctattatcatctggtcc
ctgggcaacgaggcgggacacggaaaggtttttgagaccacctatcaatggttgaaagat
cacgactcaagacctgttcaatatgaacctgcaaaaacagagcattatacagatatttat
tgccccatgtacccttcaccggagcatttagaagattacgctaaaagcaatcctcaaaaa
ccggcaataatgatagaatatgcccatgcgatgggaaattctgtagggaatttacaggat
tactgggacatcatagagaattatgatgtccttcagggagggtttatttgggattgggta
gatcaagcccttgaatataaatatcccgatgggaaaccttatttagcttatggatatgat
taccacccagatcttcctaccgatggaaattttttaaataatggtttggttgatccctat
cggaatccacacccacatttatctgaagtaaaaaaagtttaccaaccggttgaatttaaa
tttgataaagcttcttcgatattacaaattttcaataaaaatttctttaaaacatttgat
gatgaacaaattatatggaaacttctggaaaatggaaaaagcatagactcaggaagggtt
tctttaaatgaaatcaaaccgagaacagaacaggactatcaattaaaatttgacagagcc
tcttcagataaaaatgaacttatattacaggtttatttaaaaaccgattccgaagaagtt
ctactaccggcagatcacttattagcttttgaagaatttttattatcagcatttgaagga
tcagatttcaaacctgtaagcaacgatgacgtaaatattacttctcaacataacaccatt
ttgatcaaaggaaataactttcaattaagtttggataagatttccggggaaatcaaggaa
tggagatataataataaattgattaccaatgagcccatacacttaaatttctggcgtgct
cctacagataatgaccttggaaacggaatggataaatgggctaaaatatggaaaacggct
acgcataattatacttcgaaactaactaaacaaccagtgcttaacaataaaacagttgct
tttgaagtggcttataagcttcctgaaaatattgcgaagataaatgtagtgtacgaagta
aattctaatggtgatcttaaaatcaactataaatttgaaccactgaaagaggagctacca
aatattccaagaattggaatgtatatgattttaccatccgacttcaaagaagtaagctgg
tatggtaaaggaccgggagagacttattgggatcgcaaaacgggtcaacaaaccggtatt
tattcaggtaaaatcgaagatcaatttcataggtacttaagaccgcaggaaacgggcaat
aaaacagaggttagatggatgaagctggagtctgagggtcttactctttcagcatttgcg
acgaattcgttattgaattcaagtatatggccttttgaaatggcagaaattgatctggaa
gaaaatgaaattgcggcatctgcttccggacttgtaccggtaactaaaaagcatggagct
gatattgaatttggtgaaaatatgcaatggaatatagatcatctgcaaatgggcgttggt
ggtgatacttcctggggaaggctggtacacccggaatatacaatccaacctaaatcctat
tcatatagttttataatcaggccaactcaaaagagatag

DBGET integrated database retrieval system