KEGG   Gramella forsetii: GFO_1948Help
Entry
GFO_1948          CDS       T00448                                 

Definition
GDSL-like lipase/acylhydrolase (EC:3.1.-.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gfo  Gramella forsetii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GFO_1948
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GFO_1948
   3.1.2  Thioester hydrolases
    3.1.2.-  
     GFO_1948
Lipid biosynthesis proteins [BR:gfo01004]
 Fatty acid synthase
  Component type
   GFO_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049417..2050103)
Genome map
AA seq 228 aa AA seqDB search
MRSFTLFLSLFMFLFISSCGEVTKKDEKETNQELEENESEKDDKPKVILFFGDSLTAGYG
LEQEEAFPAIIQNKIDSLKLSYKVLNAGLSGETTSGGKNRIDWVLKQNVDVFILELGAND
GLRGIPVEETRNNLQAIIDFVRAKNPDIEIILAGMQIPPNMGQEYTSDFKRIFPDLAEKN
EVHLIPFLLEDVAGNPELNQQDGIHPTAEGQKILAENVWEVLQPIINN
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcttcaccttatttttatcattgtttatgtttttgtttatttcttcctgtgga
gaggtgacgaaaaaagatgaaaaggagaccaaccaggagttagaagaaaatgaatctgaa
aaggatgataagccgaaggtgatccttttttttggagatagcctcactgcaggttacgga
ttggaacaggaagaagcttttcctgcaattattcagaataaaatagattctctaaagctt
tcttataaggttttaaatgcaggtttgagtggagaaactacctccggaggtaaaaaccga
atagactgggtgcttaaacaaaatgtagacgtgtttatattggagttgggagcgaatgat
ggtttaagaggaattcctgtagaggaaacccgaaataatcttcaggcaataattgatttc
gtaagagctaaaaatccagatattgaaattattctggcaggaatgcaaattccgccaaat
atgggtcaggagtatacctctgattttaaaagaattttccctgatcttgctgaaaaaaat
gaggtacatctaattccgtttctactggaagatgtggccgggaaccctgaacttaatcaa
caggatggaattcatccaacggctgaagggcagaagatacttgctgaaaatgtttgggaa
gtgttacaaccgataataaataattag

  All links  
No link information was found.   
DBGET integrated database retrieval system