KEGG   Gramella forsetii: GFO_1960Help
Entry
GFO_1960          CDS       T00448                                 

Definition
two-component system sensor histidine kinase/methyl-esterase/transferase hybrid
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
gfo  Gramella forsetii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GFO_1960
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GFO_1960
Enzymes [BR:gfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     GFO_1960
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GFO_1960
Two-component system [BR:gfo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GFO_1960
Bacterial motility proteins [BR:gfo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GFO_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2063567..2067226)
Genome map
AA seq 1219 aa AA seqDB search
MENTKEVSTVATVNESNIDQPRIVAVGASAGGLEALKAFFKNISANDKSAFVVIQHLSPD
YKSMMGELLSKNSNLPIVQIKDQMEIKKGHIYLIPPANNLVLEDEILRLTEKPKNQTLNL
PIDMFFESMAKQRKERAIGVVLSGTGSDGTRGTRAIKENDGMVMVQNPKQAKFDGMPKSA
INTGLVDYILPVEEMGPELKDFISSPPIFHFKDGDVQYDEKELNKILNYIDEKSGLDFRE
YKYATLARRVARRVNICKCQNLKEYYNFLTSENEEVEILYREFLIGVTKFFRDDEVWESL
MTHVFPKMIHEKADGEILKVWDVACSTGEEAYSFAMCLHEEMEKQGKNIEIKIFATDISQ
PHLDIGSKGFYPESIVADVSKDFLLKYFVSKSNGYKVSDRIRRSVVFSRHNIIKNPPFSN
MDMVVCRNLLIYFQNSIQKKALNMLHYALKENGVLVLGTSESVHSHQENFSEIDRKWKIY
KNIKPSTRLKNGVGQASISENSTAELHQNKAKRKRKATRPHSNPIRQKLQGELNEMILEQ
FGGASVFVDSDYNILQAVGEFRKYANLPVSGFSINLLDMLDTELKYAVQSTFNKAFKEDR
KVVYRDAVINQRSERFGADIIVKPFKDYSLGGETNYIISFIEKDIDFEEIEEVAKISPSS
QTKEYVASLENELKDTKEDLQTSLEEIETSNEELQAANEELLASNEELQSTNEELQSVNE
EINTVNAENVQKMDDLAALNADMNNLLKSTDIGVIFLDSDFKIRKFTPAIKKHFSLINGD
LGRPIDNFTNSFGLTRKQSFLDRCDRVLKTGKVLEKHIVSREGKNYLQRISPYMESNNEI
NGVVISFIDIESIQKSKERLIASEKRFKSFYEDDPVLHISVDSETSKIIHCNKKAIQKLG
YETKEDLIGKLIPDLFDKDSQAVVMQLKSSIKKSGELINLDQNMVTKKGRLLPVILNATA
EKDEDDKLKTIRYTCVDISALKKAQEQLKEQKNDLERANRDLEQFVSICSHDLQEPLATI
KFGSDVLGKMYASKLDEKGENYIKYIKDASDRLSAQIRALLEHSRIGKNGNKTLVNTKEM
VEVVKYDLGKRIRDSKAQIHTGALPKIKAYEVELRLLFQNLISNAIKYVPKDRKPEIRIS
AYREDKHWVFSIVDNGVGISEEDQRNIFTIFNRVPGNDDMEGTGVGLAHVEKIVLLHEGT
IWVDSQVGVGSTFYFKLKA
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatacgaaagaggtttctacagtagcaactgtaaatgaaagtaatatagatcaa
ccaagaatagttgcagttggagcgagtgctggcggattagaagccttaaaggcattcttc
aaaaatatttctgctaatgataaaagtgcttttgttgtaattcagcatttatccccggat
tacaaaagcatgatgggtgagcttctaagtaagaatagcaatctaccaattgttcagatc
aaagatcagatggagattaaaaaggggcatatataccttatcccaccagccaataatctt
gttctcgaagatgaaattctcagacttactgaaaagcctaaaaaccagaccctcaatctg
cctatagatatgtttttcgaatctatggcgaagcaaagaaaagaaagggctattggggta
gtattgagtggtacaggtagtgatggtaccaggggaaccagggctattaaggaaaatgat
ggaatggtgatggtgcagaatcccaaacaggcaaagtttgacgggatgccgaagagtgcc
attaataccggtcttgtagattatattttacctgtagaagagatggggcccgagttaaaa
gattttatttcaagtcctcctatatttcattttaaagatggcgatgttcaatacgatgaa
aaggaattaaataaaatacttaattatatcgatgaaaagtctggactggactttagagaa
tataaatatgctacgctggccagaagagttgccagaagggttaatatctgcaaatgtcaa
aatttaaaggaatattataactttttaaccagtgaaaatgaggaagtagaaattttatat
agagaatttcttattggggttacaaagttttttcgtgatgatgaagtatgggaatctttg
atgactcatgtttttccaaaaatgattcacgaaaaagcggacggggaaattttaaaagtc
tgggatgtagcatgtagcaccggtgaggaagcatattcttttgctatgtgtttacatgaa
gaaatggaaaaacagggtaaaaatattgagattaaaatttttgctacagatatttctcaa
ccgcatcttgatattggtagtaaggggttctatccggaaagcatcgttgccgatgtgtct
aaagattttttacttaaatacttcgttagtaaatctaatggatataaggtttctgataga
ataaggagatcggttgttttttccagacataatattattaagaatccacctttcagtaat
atggatatggtggtatgtcgaaatctgcttatttatttccagaatagtattcagaagaaa
gcacttaatatgttgcactatgctttaaaggaaaatggggtgctcgttttgggaaccagc
gaaagtgtacattcccaccaggaaaatttcagcgagatagataggaaatggaagatctat
aaaaatattaaaccaagtaccagacttaaaaacggagtaggtcaagcatctatttctgaa
aattcaacagcagaattgcatcaaaataaggctaaaagaaaacgaaaagcaaccaggcca
cattcaaatcccattcggcaaaagttacagggagaattgaatgaaatgattctggaacaa
tttgggggagcctctgtctttgttgattcagattataatattcttcaggctgtgggcgag
ttccggaaatatgccaatttaccggtaagcgggttttcgataaacttattagatatgctg
gatactgaacttaaatatgctgttcagtctacatttaataaagcatttaaggaagacaga
aaggtggtttatcgtgatgcagtaatcaatcaaagaagtgagaggtttggtgcagatata
atagtaaaaccatttaaagattatagtcttgggggtgaaactaattatatcatctctttt
atagaaaaggatattgattttgaagaaatagaagaggtcgctaaaattagtccatcaagt
caaaccaaggaatatgtcgcaagccttgaaaatgaattaaaggatactaaagaagatctg
caaacctcactggaggaaatagaaaccagtaacgaggaattacaggctgcaaatgaggaa
cttctggcttccaatgaagaattacagagtaccaatgaagaactccagagtgtaaatgaa
gagataaatacggtaaatgccgagaatgttcagaagatggatgatctggcagcattaaac
gccgatatgaataaccttctgaaaagcaccgatattggagtgattttcctggattctgat
tttaaaattcgaaagtttacgccagctatcaaaaagcatttcagtcttataaatggggat
ctaggcaggcctatagataatttcaccaatagttttggtttgaccaggaaacaaagcttt
ctggatcgctgcgatagagtgctgaaaaccggaaaagtgcttgaaaagcacattgtttcg
agagaagggaagaattacctgcaaagaatttctccttatatggaatctaacaatgaaata
aacggagtggtaatttcttttattgatattgaaagtattcaaaaatctaaagagcgatta
attgctagtgaaaagcgtttcaaatctttttatgaggacgatcctgttttacatattagt
gtagattcagaaacttcaaaaattatacattgtaataagaaagctattcaaaagcttgga
tatgaaactaaagaggatcttataggaaaattaataccagatttatttgataaagattct
caggcggtagtaatgcaattaaagtccagtattaaaaaatcgggggaattaatcaatctt
gatcagaatatggtcacgaaaaaaggaagattattaccggttattttaaacgcaacggca
gagaaggacgaggatgataaacttaaaacaatacgttatacctgcgttgatatctcggca
cttaagaaagctcaggaacaattaaaagagcagaaaaatgatcttgaaagagcaaatcgg
gatcttgagcaatttgtatctatatgctcccatgaccttcaggaacctttggcaaccatc
aaatttggtagtgatgtactgggaaaaatgtatgccagtaaattggatgaaaaaggtgaa
aactatataaaatatattaaggacgcctcagacaggctttcggctcaaatacgtgcattg
ctggaacattccagaattggtaagaatggtaataaaacactggtgaataccaaagagatg
gttgaggttgttaaatatgacctcggaaaaagaattagggattctaaagcccagatacat
acaggcgctttaccaaagataaaagcttatgaggttgagttaagattgttatttcagaat
ttaattagtaatgctattaaatatgttccaaaagacagaaaaccagaaataagaatttct
gcctatagagaagataaacattgggtattttctatcgttgataatggagtaggtatttca
gaagaagatcagcgaaacatatttaccattttcaatagggttcctggaaatgatgatatg
gaaggaaccggagttggtcttgcccatgtagagaaaattgtattgctgcacgaaggaact
atttgggtagactcgcaagtcggagtaggaagtactttttactttaaattaaaagcttaa

DBGET integrated database retrieval system