KEGG   Gramella forsetii: GFO_1968Help
Entry
GFO_1968          CDS       T00448                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gfo  Gramella forsetii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GFO_1968 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GFO_1968 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GFO_1968 (thrC)
Enzymes [BR:gfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GFO_1968 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2078156..2079451)
Genome map
AA seq 431 aa AA seqDB search
MNYFSLNNREHTSNFENAVVRGLAPDKGLYFPDKIKKLPASFFQNIGNLDRTEISFEAIK
AYVGDEIPDSALIDIINETVDFEFPIVDVKKNIGSLELFHGPTLAFKDVGARFMAGSLGY
FIKKGNLGKITVLVATSGDTGGAVANGFLGIEGIDVVILYPKAKVSEIQEKQLTTLGQNI
TALEVDGNFDDCQAMVKKAFLDSEITDHRKLTSANSINVARWLPQMFYYFFAYKQLKEID
KKLVFSVPSGNFGNICAGLLAREMGLPIDHFVASNNANDTVTNYLETEEYNPKPSVQTIS
NAMDVGDPSNFVRVLKLFKDKHANLKEHFSAYSFDDEKTKQAIKEVYSETKYVMDPHGAV
GYLGLKKFLESNPEYHGTFLETAHPVKFLETVEAAIKKKVEIPDSIKGLMDKQKKSLQIS
NYDELKNYLLQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttcagcttaaataacagggagcataccagtaattttgaaaatgccgtggtt
cgcggattggctccggacaagggactttatttcccggataagattaaaaaacttcctgcc
tctttttttcaaaatattggaaatctggatagaactgagatttcctttgaagcaattaaa
gcatacgtaggtgatgaaattccagattcagcgttaatagatattattaacgaaacggta
gattttgaatttccgattgttgatgtaaaaaagaatattggaagcctggaactttttcat
ggacctacccttgcatttaaagacgtaggagccaggtttatggcgggtagtttagggtat
tttatcaaaaaagggaacctgggaaaaatcactgttttggtggctacttcaggagatacc
ggtggagcagtagctaacggatttcttggtattgaaggaatagatgtggtcatactgtac
ccaaaagctaaggtgagtgaaattcaggaaaaacagcttacaactttaggtcaaaatatt
acggctctggaagttgatggtaattttgatgattgccaggcgatggtaaaaaaagctttt
cttgattctgaaattacagatcatagaaaacttacctcggcgaattctattaatgtggcg
agatggctaccgcaaatgttctattacttttttgcttataaacagttgaaggaaatagac
aaaaaattagtgttttcggttccaagcgggaatttcggtaatatctgtgctggcttgcta
gctcgggagatgggattacccatagatcattttgtcgcttcaaacaacgccaatgatacc
gttaccaattatctggaaactgaagagtataatccgaaacctagtgtgcaaactatctcc
aatgctatggatgtaggagatcctagtaactttgttagagttcttaaattatttaaggac
aaacatgctaatctaaaagaacatttttcggcatatagttttgatgatgagaaaacgaaa
caagctattaaagaggtgtattcagaaacaaagtatgtgatggatcctcatggtgcggtt
ggttatcttggattgaaaaaattcctggaaagtaatcctgaatatcacggtactttcctt
gagactgcacatccggtgaagtttttagaaactgtagaagctgccattaagaaaaaggta
gagattccagattctattaaaggcttaatggataaacaaaaaaaatcccttcaaatcagc
aattatgatgagctgaaaaattatcttctacaatag

DBGET integrated database retrieval system