KEGG   Gramella forsetii: GFO_1975Help
Entry
GFO_1975          CDS       T00448                                 

Definition
magnesium chelatase subunit Chll (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gfo  Gramella forsetii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gfo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2086572..2088035)
Genome map
AA seq 487 aa AA seqDB search
MNKEKIKNLGELKEAGYKSKSIKDELRDNLKQKIRNKENAFKGIHGYDYTVIPELERAIL
SRHNINLLGLRGQAKTRLARLMVQLLDEWMPVVEGSEINDDPLQPISRYARELINEKGAK
TPISWIHRDERFFEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANRSI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRLPLDMQFIFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPEDIATAKIITTQEAQLDERQKEFVHVPDIARDLLEQISFEARDSEFI
DHKSGVSARMSITAFENLLSTAERRAIRNDEEKTLLRFGDFLGVIPSITGKVELVYEGEQ
EGAAFVAQQLIGDSVKTLFPDYFPAIEKLQKPDETTPYDDLVEWFFESSGFELPDDLTDA
EYKAELDSIEPLNKLIEKYQPEVKDEDKYFIKEFLLWALVEYKKLSKKRFSKGLQFKDLY
GSYISGL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaaaaaataaagaatcttggagagctgaaagaagctggatacaaaagcaaa
agtatcaaagatgaacttcgggataatcttaagcaaaaaataagaaataaagaaaatgct
tttaagggaattcatggatacgattataccgtaatcccagaattggaaagagctattctt
tcaagacataatattaatctgctgggtttacgaggccaggctaaaacgagacttgccagg
ttaatggtacagcttttagatgaatggatgccggttgtggaaggttcagaaattaatgat
gatcctttacaaccaattagtagatatgccagggagcttattaatgagaaaggggctaaa
accccaatttcttggatacatagggatgagcgtttttttgagaaattagcaactccagat
gtcactgttgccgacctgatcggagatgtagaccctattaaagcagccaatttaaagttg
agttatgctgatgatagggtgattcacttcggaatgattccacgtgcaaatagaagtatt
tttgtgatcaatgaattgccagatcttcaggcaagaattcaggtagcacttttcaatata
ttacaggaaggtgatattcaaattagaggttttaaactgagactgcccttggatatgcaa
tttattttcactgcgaatcctgaagattacaccaacaggggaagcattgtgactccgctg
aaagacaggattggttcacagattttaactcattatccggaagatattgccactgcaaag
atcattaccactcaggaagctcaactggatgaaagacaaaaggaatttgtgcacgttccc
gatattgccagggatctattggagcagattagttttgaagcacgagacagcgaatttata
gatcataaaagtggcgttagtgcgagaatgagcattacagcttttgaaaatttattaagt
actgcggaaaggagagccattagaaatgatgaagaaaaaaccttattacgatttggggat
tttcttggggtgatcccatcgataaccggaaaggttgaattggtttatgaaggagagcag
gagggagcagcttttgttgcccagcaacttataggagattcggtaaaaacactttttcca
gattacttccctgcgattgaaaagcttcagaaaccagacgaaactacaccttatgatgac
ctcgtggaatggttttttgaaagttcaggatttgaattacctgatgatcttacagatgct
gaatataaagcagaattagattccatagaacctctaaataagctgatagagaaatatcag
ccggaagttaaagatgaagataaatacttcataaaagaatttctgctttgggcgttggta
gaatataagaagttaagcaaaaagagattttcaaaagggcttcaattcaaagatctttat
ggaagctatattagcggactttaa

DBGET integrated database retrieval system